MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 3
MS data file : PRT1231_JBEI_3.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:39:58 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,459

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 4266)

Page: Previous 1 2 3 4 5 6 7 8 9 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4084 540.9490 1619.8252 1619.8090 10.00 1 2 0.67 +1Score > 24 indicates identity
Score > 13 indicates homology		 GVNVQKLFMDDAQR
3729 360.8278 1079.4616 1079.4740 -11.5 0 2 3 +1Score > 19 indicates identity DMLTMGEQR
4023 379.6855 1514.7129 1514.7194 -4.30 0 2 0.8 +1Score > 23 indicates identity
Score > 14 indicates homology		 AFFYNPEQVPFR + Deamidated (NQ)
3895 652.3031 1302.5916 1302.6139 -17.1 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QIAGALDYCHR
4352 959.3340 7666.6138 7666.7082 -12.3 0 2 1.6 +1Score > 16 indicates identity GGLLMCYSFWWSLGSFFAQVALQHLAQDHPMNYLTPVYTQWAQIGLMFLIYILVPESPAWCIDAGK + 2 Deamidated (NQ); Oxidation (M)
3750 549.7785 1097.5424 1097.5577 -13.9 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NRQLQAPNR + 2 Deamidated (NQ)
4240 908.5107 2722.5103 2722.5269 -6.11 1 2 1 +1Score > 15 indicates identity STIDFNITSPLPVVASGLPVRGIIEK
4398 1114.6777 7795.6930 7795.6255 8.66 1 2 1.8 +1Score > 17 indicates identity MKPEPGVSEAGDQPVLAYPPHAPLGQVPNMHPDMRYQPQTHPNPALPLLQNPYMPGGYTSAPPMPNGGAPQGR + 6 Deamidated (NQ); 2 Oxidation (M)
3719 533.2404 1064.4662 1064.4808 -13.7 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 KMQDEAEAK + Oxidation (M)
3916 663.9073 1325.8000 1325.7779 16.7 1 2 0.86 +1Score > 14 indicates identity ALLETLNAGRIR
4122 880.3665 1758.7184 1758.7153 1.77 1 2 1.3 +1Score > 16 indicates identity NGVNGSDGSHGRNESDR + 2 Deamidated (NQ)
3506 407.7449 813.4752 813.4861 -13.3 0 2 0.8 +1Score > 23 indicates identity
Score > 13 indicates homology		 QVLWLR
4187 719.7044 2156.0914 2156.0610 14.1 0 2 0.92 +1Score > 24 indicates identity
Score > 14 indicates homology		 GVSNDGQQASIAGGIAAAHYIR + Deamidated (NQ)
4410 867.4180 7797.6965 7797.5772 15.3 1 2 1.5 +1Score > 16 indicates identity YEGQQWDGSLDTPGYLDVQQEYPPSTYATPPSSVIDGDIHDDLPAIPGPPLQAPNHLSKEQHYQAAVEHGR + 6 Deamidated (NQ)
3595 457.7762 913.5378 913.5484 -11.6 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 TIAQLLAAL + Deamidated (NQ)
4094 828.4243 1654.8340 1654.8526 -11.2 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 LETPENAQKVLNAAR + 2 Deamidated (NQ)
3546 432.2291 862.4436 862.4331 12.3 1 2 0.77 +1Score > 23 indicates identity
Score > 13 indicates homology		 QQKMTAR + Deamidated (NQ)
3443 364.2133 726.4120 726.4137 -2.21 0 2 3 +1Score > 19 indicates identity LGRPER
3998 489.2590 1464.7552 1464.7613 -4.17 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GVLLDYAQWATTK
4259 969.4843 3873.9081 3873.8578 13.0 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SPQTLQSLGSMDPALSVPQGSLNNSAGDSLPTPRSSFK + 3 Deamidated (NQ)
3878 640.2969 1278.5792 1278.6026 -18.3 1 2 0.72 +1Score > 22 indicates identity
Score > 13 indicates homology		 LENGSMKAWAR + Deamidated (NQ); Oxidation (M)
3899 652.7700 1303.5254 1303.5364 -8.37 0 2 1.2 +1Score > 15 indicates identity QCANHAADFNR + Deamidated (NQ)
3670 334.8678 1001.5816 1001.5910 -9.37 0 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology		 QIWTLTLK
4115 570.2714 1707.7924 1707.8176 -14.8 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 APQRASSYSSALEEGR
4311 953.7082 7621.6074 7621.5480 7.79 1 2 1.4 +1Score > 16 indicates identity KGGPMGVMSDLFPEVDWLSLPTPGDSLGQQPAANPAPAISIPEGTTLPPEFQQDSSNLQLNWDEWDQVMR + 4 Deamidated (NQ); Oxidation (M)
3435 716.4335 715.4262 715.4228 4.78 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NLILSR + Deamidated (NQ)
4145 623.3621 1867.0645 1867.0904 -13.9 1 2 1.4 +1Score > 16 indicates identity VRVLSPPLSHRPRPQK + Deamidated (NQ)
3471 386.2300 770.4454 770.4399 7.23 0 2 3.1 +1Score > 19 indicates identity LGGLQQR
4257 1114.5192 3340.5358 3340.4937 12.6 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LEYVWIDTCCIDKSSSAELSESINSMFR + Deamidated (NQ)
3535 422.2583 842.5020 842.4974 5.53 1 2 0.86 +1Score > 23 indicates identity
Score > 13 indicates homology		 VKGVGNLR + Deamidated (NQ)
3927 450.2278 1347.6616 1347.6630 -1.07 0 2 0.98 +1Score > 24 indicates identity
Score > 14 indicates homology		 GDSISLQSLNGTR + Deamidated (NQ)
4224 820.7167 2459.1283 2459.1494 -8.61 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IMPNPQTLVMVRSLGNVNEGCE + 2 Deamidated (NQ)
3914 441.8932 1322.6578 1322.6765 -14.2 0 2 0.99 +1Score > 24 indicates identity
Score > 14 indicates homology		 MVIQLPGQQHR + Deamidated (NQ); Oxidation (M)
3852 619.8748 1237.7350 1237.7142 16.8 1 2 1.3 +1Score > 15 indicates identity IAVSNLHKQTK
4372 1112.2467 7778.6760 7778.7407 -8.32 1 2 1.6 +1Score > 16 indicates identity IWNRPPNFLLVDYYNYGPVNGTVFEVAAQMNNVTYNGKCCGVASAGMSLTPQSVMATALMIGGIQFLVSLF + 3 Deamidated (NQ)
3325 556.3122 555.3049 555.3017 5.89 0 1 2.6 +1Score > 18 indicates identity AGSPPK
3889 645.7756 1289.5366 1289.5524 -12.2 0 1 1.6 +1Score > 16 indicates identity GWSSVEENPQR + 2 Deamidated (NQ)
4222 813.7581 2438.2525 2438.2475 2.03 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NVGMLEVVNEPVQNPQVTTTLR + Deamidated (NQ)
4105 838.8859 1675.7572 1675.7763 -11.4 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NATWTQLPMGEPVSK + 2 Deamidated (NQ); Oxidation (M)
3829 602.2952 1202.5758 1202.5527 19.2 0 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 NNEVSEINQR + Deamidated (NQ)
3544 429.7399 857.4652 857.4607 5.35 1 1 0.86 +1Score > 24 indicates identity
Score > 13 indicates homology		 DPQRTIK + Deamidated (NQ)
3806 586.3284 1170.6422 1170.6244 15.2 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 QLVEDIEGLR
3525 415.2452 828.4758 828.4891 -16.0 0 1 0.9 +1Score > 23 indicates identity
Score > 13 indicates homology		 LPMSLIR
3643 322.1767 963.5083 963.4960 12.7 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 QPPICPPR
3938 455.5899 1363.7479 1363.7684 -15.1 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 ELNVHAVLTGRR
3735 543.8152 1085.6158 1085.6081 7.17 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LLASTPDTIR
3791 576.2849 1150.5552 1150.5466 7.56 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 SQQSNTSLKR + 3 Deamidated (NQ)
3861 418.2364 1251.6874 1251.6935 -4.92 0 1 0.8 +1Score > 20 indicates identity
Score > 13 indicates homology		 LASTIGIAVDHR
4284 937.1614 5616.9247 5616.8293 17.0 1 1 1.1 +1Score > 14 indicates identity SDDSISIFNLVQPGFLEDNIPPSLRPTLIQRSVPHHPWLDFFPFPQMR + Deamidated (NQ); Oxidation (M)
4227 844.0992 2529.2758 2529.2421 13.3 0 1 0.96 +1Score > 23 indicates identity
Score > 14 indicates homology		 SVNFDELIALYAVSDACIVSSTR
3633 478.2374 954.4602 954.4519 8.77 1 1 0.9 +1Score > 21 indicates identity
Score > 13 indicates homology		 EAAKQDHR + Deamidated (NQ)
3847 615.3506 1228.6866 1228.6775 7.43 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 ALIDLNSTNLR
4124 883.9841 1765.9536 1765.9879 -19.4 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 APLPVIPYYPDPIRR
4045 771.9040 1541.7934 1541.7773 10.5 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 VLLMSNHEKNWR + Oxidation (M)
4188 540.5050 2157.9909 2158.0113 -9.44 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LEHCISARETVEEAYHSK
4289 869.8520 6081.9131 6081.8315 13.4 1 1 3 +1Score > 18 indicates identity MNQMNVAGMNPGAGGPVGGVPMINNGSTAPRNDGNVNNIPELMINNLNTYIYDYLLK + 3 Deamidated (NQ); 2 Oxidation (M)
4453 1123.2452 7855.6655 7855.6048 7.72 1 1 1.4 +1Score > 15 indicates identity DVGHTGYGLMRMTWVPQPPPQEQCFEALNTALAHGSNFWNAGELYGTPEYNSLHLLHSYFAQHPENADK + Deamidated (NQ); Oxidation (M)
3652 326.1718 975.4936 975.4873 6.46 0 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 NIVGTTQNK + 2 Deamidated (NQ)
3900 653.7729 1305.5312 1305.5507 -14.9 0 1 1.9 +1Score > 16 indicates identity GSTLDDPMPNSR + Deamidated (NQ); Oxidation (M)
4028 764.3588 1526.7030 1526.7109 -5.13 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 MCLGSNFALQEIK + Deamidated (NQ); Oxidation (M)
3524 414.7350 827.4554 827.4501 6.48 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 TAAAPIER
3985 481.9149 1442.7229 1442.7374 -10.1 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 GLGDIKNMVPMPR + Oxidation (M)
4107 560.9282 1679.7628 1679.7897 -16.0 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GSTQVQGERMSQGATK + Oxidation (M)
3978 477.2627 1428.7663 1428.7936 -19.1 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 AEAEVSRLQTVVK
3805 586.3226 1170.6306 1170.6244 5.32 0 1 0.91 +1Score > 23 indicates identity
Score > 13 indicates homology		 IILENPTQSR + Deamidated (NQ)
4110 564.6282 1690.8628 1690.8898 -16.0 1 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 IAKFGGKPAQLMMDGK
3934 455.2514 1362.7324 1362.7190 9.81 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MAIPSKGPAQHAR
3714 527.7658 1053.5170 1053.5203 -3.11 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 HTTPASPSTR
3702 523.2831 1044.5516 1044.5451 6.28 1 1 0.89 +1Score > 25 indicates identity
Score > 13 indicates homology		 EREQQLLK + 2 Deamidated (NQ)
4067 792.4349 1582.8552 1582.8566 -0.86 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 AISIEDEQLITPVR
4261 993.9665 3971.8369 3971.8292 1.94 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GVSENLILGQMAPAGTGEFDIYLDQNMLNTVVSNNAR + 5 Deamidated (NQ); Oxidation (M)
4312 1089.8087 7621.6100 7621.7155 -13.8 1 1 1.7 +1Score > 16 indicates identity TYLCLGMVVLTAATNGYDGSMMNGLQTLEPWQEYFDHPSGSLLGILSAIMSLGSLAALPAVPYTADLLGRR + 3 Deamidated (NQ); 2 Oxidation (M)
3993 487.2590 1458.7552 1458.7289 18.0 1 1 0.91 +1Score > 24 indicates identity
Score > 13 indicates homology		 IQGGEKAAHLFCK + Deamidated (NQ)
4019 756.3477 1510.6808 1510.7007 -13.1 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LVMEMAKQNTDSK + Deamidated (NQ); Oxidation (M)
4026 506.2460 1515.7162 1515.7391 -15.1 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ISAEEALQHPYMK
4232 867.4310 2599.2712 2599.2417 11.4 0 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 NMWNFNLADAAFGFLVLEIEAGR + 2 Deamidated (NQ)
3687 514.8118 1027.6090 1027.6026 6.30 0 1 0.87 +1Score > 21 indicates identity
Score > 13 indicates homology		 VGIALESALR
3731 542.2807 1082.5468 1082.5509 -3.73 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ALDDFLHPR
3449 368.2069 734.3992 734.4075 -11.3 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 AVQYVR
3632 475.7587 949.5028 949.4981 4.99 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 QKYLQDR
3778 564.8326 1127.6506 1127.6411 8.50 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 TILRQAQAAR + Deamidated (NQ)
3523 414.2737 826.5328 826.5388 -7.26 1 1 1.3 +1Score > 14 indicates identity IVKQALR
3849 617.3118 1232.6090 1232.5932 12.9 1 1 1 +1Score > 25 indicates identity
Score > 13 indicates homology		 IMNIDQGRDR + Oxidation (M)
3728 539.3039 1076.5932 1076.5760 16.0 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 MVALRTSAGR + Oxidation (M)
3842 611.8413 1221.6680 1221.6903 -18.2 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 QAFMRSLILK + Oxidation (M)
4135 608.9509 1823.8309 1823.8168 7.71 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 KIQQQQMQEMLAAQK + 6 Deamidated (NQ); Oxidation (M)
3725 537.2859 1072.5572 1072.5400 16.0 0 0 1 +1Score > 25 indicates identity
Score > 13 indicates homology		 VVPTNNATEK + Deamidated (NQ)
4228 854.1046 2559.2920 2559.3043 -4.81 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 EDYVDVLIVGAGPAGLMLANWLSR + Deamidated (NQ)
3555 435.7757 869.5368 869.5334 3.93 0 0 3.8 +1Score > 19 indicates identity TPLASIIR
4267 949.4807 4742.3671 4742.2906 16.1 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QVGWTLMLSHESPMLKPHWAFPSLCGPKTGLIGCVGVDADYR + 2 Oxidation (M)
3526 415.7421 829.4696 829.4810 -13.7 1 0 0.97 +1Score > 25 indicates identity
Score > 13 indicates homology		 FHGKTIK
3553 435.7584 869.5022 869.4970 5.99 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 KALDQAPK
3986 724.8990 1447.7834 1447.7671 11.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LLDNKYIVQDAR + Deamidated (NQ)
4220 608.8131 2431.2233 2431.2554 -13.2 1 0 0.97 +1Score > 23 indicates identity
Score > 13 indicates homology		 LGARTSTIQVTLSQDAASTGPQTK + Deamidated (NQ)
3955 693.3084 1384.6022 1384.6120 -7.02 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 GAYPDPRDSHNR + Deamidated (NQ)
3631 317.1883 948.5431 948.5393 4.02 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 KQAGVTAFK
3577 447.7403 893.4660 893.4607 6.03 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ISQDLYR
4282 936.9945 5615.9233 5615.8765 8.35 1 0 1.8 +1Score > 15 indicates identity LDLVHHMFSVMLNGELFLAPVENPQTILDLGTGTGIWAIDVAEYIFPFKK + Deamidated (NQ); Oxidation (M)
4136 610.9537 1829.8393 1829.8539 -8.02 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 GDDGQPIMPQGMVDLIK + Deamidated (NQ); Oxidation (M)
3378 323.2017 644.3888 644.3857 4.87 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 AVNLTK
Page: Previous 1 2 3 4 5 6 7 8 9 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/