Mascot Search Results

User                   : Jennifer
Email                  : [email protected]
Search title           : 3
MS data file           : PRT1231_JBEI_3.mgf
Database               : A-oryzae 20191108 (12205 sequences; 5465702 residues)
Timestamp              : 1 May 2025 at 20:39:58 GMT
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 20 ppm
Fragment Mass Tolerance: ± 0.1 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-FTICR
Number of queries      : 4459



Protein hits           : IGF1_BOVIN Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal


  FHP_YEAST Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHB1 PE=1 SV=2


  Q2U2R5_ASPOR WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000349 PE=4 SV=1


  Q2UK92_ASPOR AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1


  Q2UHF6_ASPOR Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1


  TRYP_PIG Trypsin OS=Sus scrofa PE=1 SV=1


  Q2U034_ASPOR SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1


  Q2U287_ASPOR UTP--glucose-1-phosphate uridylyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000558 PE=3 SV=1


  Q2U480_ASPOR eIF-5a domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000450 PE=4 SV=1


  Q2UPG4_ASPOR Delta-aminolevulinic acid dehydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001652 PE=3 SV=1


  Q2ULW0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000247 PE=4 SV=1


  Q2UJR1_ASPOR Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1


  Q2U0N5_ASPOR GAT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000365 PE=4 SV=1


  Q2U813_ASPOR Kinesin-like protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000612 PE=3 SV=1


  Q2U8R9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000317 PE=4 SV=1


  Q2UU14_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000505 PE=3 SV=1


  Q2UPJ0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001622 PE=4 SV=1


  Q2UR52_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000967 PE=4 SV=1


  Q2UK62_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1


  Q2UKB4_ASPOR Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1


  Q2U0S3_ASPOR MaoC-like domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000326 PE=4 SV=1


  Q2U1V7_ASPOR ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1


  Q2UMK6_ASPOR WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000719 PE=4 SV=1


  Q2UV06_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000100 PE=4 SV=1


  Q2TZC1_ASPOR Serine hydroxymethyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000915 PE=3 SV=1


  Q2TVX9_ASPOR Actin binding protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=Aoabp1 PE=4 SV=1


  Q2UGJ5_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000818 PE=4 SV=1


  Q2U9Y9_ASPOR Terpene cyclase/mutase family member OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000611 PE=3 SV=1


  Q2UU93_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000407 PE=4 SV=1


  Q2UCH1_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090012000591 PE=4 SV=1


  Q2U385_ASPOR RelA_SpoT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000141 PE=4 SV=1


  PEPA_ASPOR Aspergillopepsin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pepA PE=1 SV=2


  Q2UFH8_ASPOR SF3b1 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090026000203 PE=4 SV=1


  Q2U8D0_ASPOR CIA30 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000476 PE=4 SV=1


  Q2TWP0_ASPOR ATP synthase subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000482 PE=3 SV=1


  Q2UQ81_ASPOR AP complex subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001357 PE=3 SV=1


  Q2UM83_ASPOR DRIM domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000101 PE=4 SV=1


  Q2TZM7_ASPOR DNA helicase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000793 PE=3 SV=1


  Q2U8V5_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000278 PE=4 SV=1


  Q2U267_ASPOR Arrestin_N domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000582 PE=4 SV=1


  Q2UHE7_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000477 PE=4 SV=1


  Q2US03_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000620 PE=4 SV=1


  Q2UHA9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000518 PE=4 SV=1


  Q2U9F0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000055 PE=4 SV=1


  Q2U724_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000001 PE=4 SV=1


  Q2U984_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000133 PE=3 SV=1

Select Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score or expect cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups    Require bold red

    All queries     Unassigned     Below homology threshold     Below identity threshold

1.    IGF1_BOVIN    Mass: 42206    Score: 1232   Matches: 77(52)  Sequences: 24(20)  emPAI: 16.58
 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3333   579.3172   578.3099   578.3064   6.07 0  30  0.017 1  U    K.GIDFK.E
 3388   328.1958   654.3770   654.3741   4.51 0  35  0.00046 1  U    R.TIFFK.D 3387
 3389   655.3849   654.3776   654.3741   5.39 0  (30) 0.0014 1  U    R.TIFFK.D
 3489   395.6833   789.3520   789.3479   5.20 0  14  0.29 1  U    R.YPDHMK.Q 3488
 3516   411.2027   820.3908   820.3868   4.94 0  30  0.011 1  U    K.QHDFFK.S 3517
 3520   826.4166   825.4093   825.4055   4.65 0  (26) 0.015 1  U    K.FICTTGK.L
 3522   413.7123   825.4100   825.4055   5.53 0  37  0.0013 1  U    K.FICTTGK.L 3521
 3600   307.1847   918.5323   918.5287   3.90 1  (13) 0.23 1  U    K.NGIKVNFK.I
 3601   460.2740   918.5334   918.5287   5.18 1  (14) 0.19 1  U    K.NGIKVNFK.I
 3602   307.5128   919.5166   919.5127   4.22 1  (26) 0.017 1  U    K.NGIKVNFK.I 3603
 3604   460.7662   919.5178   919.5127   5.60 1  32  0.0044 1  U    K.NGIKVNFK.I 3605
 3656   328.1715   981.4927   981.4879   4.82 0  (16) 0.21 1  U    K.EDGNILGHK.L
 3657   491.7538   981.4930   981.4879   5.20 0  54  3.5e-005 1  U    K.EDGNILGHK.L
 3712   525.7671   1049.5196   1049.5142   5.21 0  62  8.5e-006 1  U    K.FEGDTLVNR.I 3713
 3873   633.7963   1265.5780   1265.5710   5.56 0  64  3.7e-006 1  U    K.SAMPEGYVQER.T 3872
 3882   641.7935   1281.5724   1281.5659   5.08 0  (58) 1.4e-005 1  U    K.SAMPEGYVQER.T 3883
 3923   449.8932   1346.6578   1346.6507   5.28 1  (51) 0.00011 1  U    R.TIFFKDDGNYK.T 3925
 3924   674.3363   1346.6580   1346.6507   5.48 1  65  5e-006 1  U    R.TIFFKDDGNYK.T 3922
 3970   474.2516   1419.7330   1419.7254   5.34 0  (53) 6.9e-005 1  U    R.LEMYCAPLKPAK.S
 3971   710.8738   1419.7330   1419.7254   5.40 0  61  1e-005 1  U    R.LEMYCAPLKPAK.S
 3983   718.8711   1435.7276   1435.7203   5.11 0  (34) 0.004 1  U    R.LEMYCAPLKPAK.S
 3984   479.5839   1435.7299   1435.7203   6.66 0  (44) 0.00045 1  U    R.LEMYCAPLKPAK.S
 4002   739.3894   1476.7642   1476.7572   4.74 1  68  2.3e-006 1  U    R.AEVKFEGDTLVNR.I 4003
 4005   493.2628   1476.7666   1476.7572   6.31 1  (62) 7.4e-006 1  U    R.AEVKFEGDTLVNR.I 4004 4006
 4017   752.3374   1502.6602   1502.6525   5.14 0  111  6.2e-011 1  U    K.FSVSGEGEGDATYGK.L 4015 4016
 4031   767.4211   1532.8276   1532.8198   5.09 1  39  0.00092 1  U    K.FEGDTLVNRIELK.G
 4032   511.9503   1532.8291   1532.8198   6.02 1  (20) 0.071 1  U    K.FEGDTLVNRIELK.G
 4038   771.9023   1541.7900   1541.7838   4.05 1  (2) 8.4 1  U    K.GIDFKEDGNILGHK.L
 4039   386.4550   1541.7909   1541.7838   4.60 1  (27) 0.026 1  U    K.GIDFKEDGNILGHK.L 4041 4042
 4043   514.9381   1541.7925   1541.7838   5.63 1  56  3.4e-005 1  U    K.GIDFKEDGNILGHK.L 4040 4044
 4047   776.8508   1551.6870   1551.6810   3.89 0  57  1.4e-005 1  U    R.APQTGIVDECCFR.S
 4048   518.2365   1551.6877   1551.6810   4.29 0  (15) 0.24 1  U    R.APQTGIVDECCFR.S
 4061   394.9660   1575.8349   1575.8265   5.33 1  (24) 0.045 1  U    R.RLEMYCAPLKPAK.S 4060
 4062   526.2858   1575.8356   1575.8265   5.76 1  (33) 0.0052 1  U    R.RLEMYCAPLKPAK.S
 4068   531.6174   1591.8304   1591.8214   5.63 1  34  0.0043 1  U    R.RLEMYCAPLKPAK.S 4071
 4069   398.9649   1591.8305   1591.8214   5.71 1  (26) 0.031 1  U    R.RLEMYCAPLKPAK.S 4070
 4076   402.9386   1607.7253   1607.7191   3.85 1  13  0.44 1  U    R.YPDHMKQHDFFK.S
 4081   403.1901   1608.7313   1608.7031   17.5 1  (13) 0.62 1  U    R.YPDHMKQHDFFK.S 4080
 4100   834.3984   1666.7822   1666.7740   4.97 0  48  0.0002 1  U    R.GFYFNKPTGYGSSSR.R
 4101   556.6022   1666.7848   1666.7740   6.48 0  (33) 0.0064 1  U    R.GFYFNKPTGYGSSSR.R
 4103   556.9346   1667.7820   1667.7580   14.4 0  (26) 0.031 1  U    R.GFYFNKPTGYGSSSR.R
 4113   854.9018   1707.7890   1707.7821   4.06 1  (12) 0.75 1  U    R.RAPQTGIVDECCFR.S
 4114   570.2712   1707.7918   1707.7821   5.65 1  39  0.0014 1  U    R.RAPQTGIVDECCFR.S
 4171   987.4604   1972.9062   1972.8989   3.74 0  (5) 2.7 1  U    K.LEYNYNSHNVYIMADK.Q
 4172   658.6439   1972.9099   1972.8989   5.58 0  50  9.3e-005 1  U    K.LEYNYNSHNVYIMADK.Q
 4173   658.9731   1973.8975   1973.8829   7.40 0  (24) 0.032 1  U    K.LEYNYNSHNVYIMADK.Q
 4177   664.3099   1989.9079   1989.8778   15.1 0  (47) 0.00021 1  U    K.LEYNYNSHNVYIMADK.Q
 4194   558.2731   2229.0633   2229.0524   4.89 1  30  0.015 1  U    K.LEYNYNSHNVYIMADKQK.N
 4199   562.2722   2245.0597   2245.0473   5.51 1  (26) 0.03 1  U    K.LEYNYNSHNVYIMADKQK.N
 4200   749.6946   2246.0620   2246.0313   13.6 1  (15) 0.43 1  U    K.LEYNYNSHNVYIMADKQK.N
 4221   813.4285   2437.2637   2437.2377   10.7 0  3  4.6 1  U    K.GEELFTGVVPILVELDGDVNGHK.F
 4262   895.6456   4473.1916   4473.1360   12.4 0  (3) 4.7 1  U    R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
 4263   895.6462   4473.1946   4473.1360   13.1 0  16  0.2 1  U    R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D

2.    FHP_YEAST    Mass: 44846    Score: 209    Matches: 13(8)  Sequences: 10(7)  emPAI: 0.90
 Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHB1 PE=1 SV=2
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3785   568.7740   1135.5334   1135.5258   6.76 0  45  0.00042 1  U    R.QENQYDALR.H
 3795   577.2722   1152.5298   1152.5233   5.64 0  17  0.22 1  U    R.HYSLCSASTK.N
 3830   602.3250   1202.6354   1202.6295   4.93 0  62  1e-005 1  U    K.LSAPAGDFAINK.E
 4012   500.2605   1497.7597   1497.7497   6.64 0  47  0.0002 1  U    K.NIDDLSVLMDHVK.Q
 4022   505.5914   1513.7524   1513.7446   5.11 0  (13) 0.69 1  U    K.NIDDLSVLMDHVK.Q
 4073   532.6450   1594.9132   1594.9042   5.60 0  (14) 0.099 1  U    K.VGAQPNALATTVLAAAK.N
 4074   798.4639   1594.9132   1594.9042   5.65 0  63  1.2e-006 1  U    K.VGAQPNALATTVLAAAK.N
 4075   535.2785   1602.8137   1602.8042   5.92 0  15  0.43 1  U    R.ENFPAGLVSEYLHK.D
 4082   806.4610   1610.9074   1610.8992   5.13 0  56  1.2e-005 1  U    K.ATVPVLEQQGTVITR.T
 4083   537.9772   1610.9098   1610.8992   6.57 0  (22) 0.025 1  U    K.ATVPVLEQQGTVITR.T
 4144   621.3182   1860.9328   1860.9040   15.5 0  31  0.011 1  U    K.NMLTEHTELLNIFNR.T
 4151   632.3631   1894.0675   1894.0564   5.86 0  13  0.12 1  U    K.IIVHTDTEPLINAAFLK.E
 4184   528.5560   2110.1949   2110.1826   5.82 0  15  0.059 1  U    R.ALQIKPEHYPIVGEYLLK.A

3.    Q2U2R5_ASPOR    Mass: 49765    Score: 193    Matches: 14(11)  Sequences: 14(11)  emPAI: 1.03
 WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000349 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3417   345.1967   688.3788   688.3756   4.77 0  15  0.66 1  U    K.GTVADVK.C
 3421   350.2129   698.4112   698.4075   5.34 0  41  0.00042 1  U    R.GLAVSPR.H
 3430   353.6729   705.3312   705.3268   6.27 0  1  8.5 1  U    R.VWDMR.T
 3515   410.7452   819.4758   819.4715   5.31 0  24  0.019 1  U    R.NLAIHPR.E
 3537   423.7344   845.4542   845.4494   5.70 0  30  0.016 1  U    R.LITGEADK.T
 3558   437.2489   872.4832   872.4756   8.78 0  49  0.0002 1  U    R.LWDLAAGK.S
 3622   472.2852   942.5558   942.5498   6.38 0  43  0.00052 1  U    R.LDLLVTGGR.D
 3760   557.8251   1113.6356   1113.6295   5.56 0  50  9.4e-005 1  U    K.IWNLATGALR.L
 3774   375.2169   1122.6289   1122.6298   -0.85 0  12  0.28 1  U    R.VISGHLGWVR.S
 3814   396.9019   1187.6839   1187.6761   6.52 1  29  0.0055 1  U    R.LITGEADKTIK.V
 3819   399.9049   1196.6929   1196.6877   4.30 0  30  0.0049 1  U    R.LTLTGHISTVR.G
 3921   673.3397   1344.6648   1344.6561   6.47 0  57  2.8e-005 1  U    R.EFTFASASTGSIK.Q
 3931   676.8037   1351.5928   1351.5867   4.56 0  28  0.013 1  U    R.HPYLFSCGEDK.M
 4155   960.9542   1919.8938   1919.8649   15.1 0  25  0.043 1  U    R.SLAVEPNNEWFASGAGDR.T

4.    Q2UK92_ASPOR    Mass: 63866    Score: 179    Matches: 11(6)  Sequences: 10(6)  emPAI: 0.35
 AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3483   394.7187   787.4228   787.4188   5.13 0  3  11 2  U    R.QLSSPTR.E
 3511   409.6865   817.3584   817.3541   5.33 0  1  3.3 1  U    K.WMNDPR.V
 3616   466.2686   930.5226   930.5175   5.58 0  44  0.00057 1  U    R.VPYLPSQK.T
 3726   538.2800   1074.5454   1074.5379   6.99 0  41  0.0013 1  U    R.TETVMLEPR.V
 3745   546.2766   1090.5386   1090.5329   5.31 0  (13) 0.71 1  U    R.TETVMLEPR.V
 3918   667.3486   1332.6826   1332.6786   3.03 0  44  0.00062 1  U    R.LGQLIGGAGNYDR.G
 3969   471.9238   1412.7496   1412.7412   5.93 0  38  0.0015 1  U    R.GIHLLVGEQEYR.G
 3977   715.3811   1428.7476   1428.7401   5.25 0  50  0.00016 1  U    R.YIPSVGQYLSFR.V
 4180   515.2890   2057.1269   2057.0959   15.1 0  3  2.3 1  U    R.HPIRPKPPHQGDVFYIR.Y
 4183   695.3487   2083.0243   2083.0123   5.76 0  66  3.2e-006 1  U    R.VSAAWGEAGPISHQEEFLR.N
 4225   623.8312   2491.2957   2491.2608   14.0 0  5  2.7 1  U    R.LFVFSLSPLNPGQNVPGSSHHTR.Q

5.    Q2UHF6_ASPOR    Mass: 54290    Score: 171    Matches: 8(7)  Sequences: 8(7)  emPAI: 0.51
 Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3508   408.7474   815.4802   815.4753   6.11 0  48  0.00018 1  U    K.VTLELGGK.S
 3547   432.2370   862.4594   862.4548   5.33 0  37  0.0018 1  U    K.LADLFER.D
 3683   512.7433   1023.4720   1023.4661   5.77 0  35  0.0024 1  U    R.AAFEGEWSK.V
 3717   530.7670   1059.5194   1059.5131   5.97 0  47  0.00026 1  U    K.GDVAAAAGCLR.Y
 3772   561.3220   1120.6294   1120.6241   4.80 0  31  0.0045 1  U    K.IAFTGSTLVGR.M
 3793   384.5546   1150.6420   1150.6346   6.40 0  18  0.08 1  U    R.ILVQEGIHDK.F
 3912   661.4168   1320.8190   1320.8129   4.65 0  45  3.3e-005 1  U    K.IGPAIAAGNVVVLK.T
 3988   725.3868   1448.7590   1448.7511   5.50 0  54  5e-005 1  U    K.TAEQTPLSGLYAAK.L

6.    TRYP_PIG    Mass: 25078    Score: 160    Matches: 7(6)  Sequences: 4(4)  emPAI: 1.12
 Trypsin OS=Sus scrofa PE=1 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3533   421.7601   841.5056   841.5022   4.16 0  50  5.6e-005 1  U    R.VATVSLPR.S
 3703   523.2885   1044.5624   1044.5564   5.84 0  58  2.4e-005 1  U    K.LSSPATLNSR.V
 4191   738.0436   2211.1090   2211.0807   12.8 0  (4) 4.7 1  U    R.LGEHNIDVLEGNEQFINAAK.I
 4192   738.0439   2211.1099   2211.0807   13.2 0  72  8.7e-007 1  U    R.LGEHNIDVLEGNEQFINAAK.I
 4206   762.0690   2283.1852   2283.1569   12.4 0  30  0.0099 1  U    K.IITHPNFNGNTLDNDIMLIK.L
 4207   762.3967   2284.1683   2284.1409   12.0 0  (24) 0.043 1  U    K.IITHPNFNGNTLDNDIMLIK.L
 4208   767.7335   2300.1787   2300.1358   18.6 0  (28) 0.02 1  U    K.IITHPNFNGNTLDNDIMLIK.L

7.    Q2U034_ASPOR    Mass: 131681   Score: 149    Matches: 5(3)  Sequences: 5(3)  emPAI: 0.10
 SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3368   315.6835   629.3524   629.3497   4.44 0  23  0.11 1  U    K.LNDLR.S
 3549   432.7348   863.4550   863.4501   5.71 0  63  6.2e-006 1  U    R.AGDIVSFR.N
 3698   522.7855   1043.5564   1043.5512   5.02 0  20  0.16 1  U    R.HEAPPLQPR.Q
 3780   565.7788   1129.5430   1129.5363   5.93 0  70  8.7e-007 1  U    R.NPSDATLEQR.H
 4085   541.6160   1621.8262   1621.8172   5.52 0  57  2.6e-005 1  U    R.QDQLENAHLQIGTR.I

8.    Q2U287_ASPOR    Mass: 59365    Score: 82     Matches: 10(4)  Sequences: 10(4)  emPAI: 0.31
 UTP--glucose-1-phosphate uridylyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000558 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3345   302.1983   602.3820   602.3792   4.76 0  15  0.11 1  U    R.FLPVK.T
 3385   327.1679   652.3212   652.3180   4.94 0  17  0.076 1  U    K.SDLYR.L
 3441   362.1889   722.3632   722.3599   4.62 0  14  0.31 1  U    K.VSDFQK.H
 3509   408.7547   815.4948   815.4905   5.28 0  26  0.015 1  U    R.FGGVPVIK.L
 3513   410.2479   818.4812   818.4763   6.10 0  8  0.83 1  U    K.HIPSIPR.I
 3591   303.8364   908.4874   908.4828   5.05 0  10  0.74 3  U    R.QIEHLNR.T
 3671   505.8189   1009.6232   1009.6172   6.03 0  40  0.00016 1  U    R.LLEIAQVPK.E
 3709   524.7918   1047.5690   1047.5634   5.36 0  46  0.00026 1  U    K.TCSDLLLVK.S
 3816   398.9229   1193.7469   1193.7383   7.16 1  14  0.039 1  U    R.IIKDSLLPAPK.S
 3973   475.5726   1423.6960   1423.6878   5.75 0  16  0.32 1  U    R.LEHGQLVMDPNR.F

9.    Q2U480_ASPOR    Mass: 19581    Score: 69     Matches: 6(4)  Sequences: 6(4)  emPAI: 0.89
 eIF-5a domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000450 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3594   457.7589   913.5032   913.4981   5.61 0  31  0.0066 1  U    R.ALVINDGGR.E
 3732   542.2979   1082.5812   1082.5760   4.80 0  37  0.0014 1  U    R.YLGVDLFTR.Q
 3831   403.8849   1208.6329   1208.6262   5.53 0  39  0.001 1  U    R.ISVSPQTGQHR.Y
 4010   745.3808   1488.7470   1488.7395   5.07 0  4  6.1 1  U    R.SADTVPIPCNFIR.I
 4013   749.9222   1497.8298   1497.8191   7.15 0  11  0.43 1  U    K.QGIPVVPQGELFSK.I
 4141   618.0309   1851.0709   1851.0400   16.7 0  17  0.03 1  U    R.IGDILILQGRPCQVIR.I

10.   Q2UPG4_ASPOR    Mass: 41087    Score: 63     Matches: 3(2)  Sequences: 3(2)  emPAI: 0.17
 Delta-aminolevulinic acid dehydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001652 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3666   333.1818   996.5236   996.5175   6.14 0  11  0.62 1  U    K.LIEAGMAHR.V
 3827   602.2876   1202.5606   1202.5543   5.30 0  41  0.00096 1  U    K.FSGCLYGPFR.D
 3996   488.9601   1463.8585   1463.8500   5.76 0  37  0.00025 1  U    R.SVILFGVPLHPSAK.D

11.   Q2ULW0_ASPOR    Mass: 84939    Score: 53     Matches: 3(2)  Sequences: 3(2)  emPAI: 0.08
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000247 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3694   519.2825   1036.5504   1036.5441   6.17 0  50  0.00011 1  U    K.ASVDEYILK.Q
 3727   359.8504   1076.5294   1076.5250   4.02 1  27  0.032 1  U    K.YGPQEAEKR.E
 3736   363.1982   1086.5728   1086.5920   -17.72 1  6  3.9 2  U    R.ELAQAKNLAK.A

12.   Q2UJR1_ASPOR    Mass: 74750    Score: 49     Matches: 8(3)  Sequences: 8(3)  emPAI: 0.19
 Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3434   358.2311   714.4476   714.4428   6.73 0  27  0.022 1  U    R.VAWVLK.Q
 3578   448.2323   894.4500   894.4447   6.01 0  35  0.0027 1  U    K.LYDESIR.S
 3721   533.3039   1064.5932   1064.5866   6.25 0  16  0.12 1  U    R.TITYGELLR.E
 3766   373.2139   1116.6199   1116.6139   5.36 1  27  0.02 1  U    K.VVITTDEGKR.G
 3817   598.2831   1194.5516   1194.5451   5.45 0  18  0.18 1  U    R.LNAAYNCVDR.H
 3848   616.3106   1230.6066   1230.5993   5.96 0  4  4.6 1  U    R.TGTEVPWTQGR.D
 4058   788.3886   1574.7626   1574.7576   3.20 0  19  0.16 1  U    K.VAIIYEADEPNEGR.T
 4436   979.3424   7826.6810   7826.8077   -16.19 1  1  1.8 1  U    K.EEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVEGVLAFKQPWPSMAR.T

13.   Q2U0N5_ASPOR    Mass: 19103    Score: 38     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.18
 GAT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000365 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3394   329.6997   657.3848   657.3809   5.95 0  38  0.0025 1  U    R.ALLNAR.R

14.   Q2U813_ASPOR    Mass: 51671    Score: 38     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 Kinesin-like protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000612 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3394   329.6997   657.3848   657.3810   5.93 0  38  0.0025 1  U    R.ALLDAR.D

15.   Q2U8R9_ASPOR    Score: 36     Matches: 3(3)  Sequences: 1(1)  emPAI: 0.26
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000317 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3388   328.1958   654.3770   654.3741   4.51 0  (18) 0.02 2  U    R.LTFFK.A 3387
 3389   655.3849   654.3776   654.3741   5.39 0  30  0.0014 1  U    R.LTFFK.A

16.   Q2UU14_ASPOR    Mass: 53719    Score: 36     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000505 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3838   406.8654   1217.5744   1217.5888   -11.82 1  36  0.0036 1  U    K.NKTNVEVDAAR.D

17.   Q2UPJ0_ASPOR    Mass: 20065    Score: 36     Matches: 4(3)  Sequences: 4(3)  emPAI: 0.59
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001622 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3531   419.7627   837.5108   837.5072   4.32 0  2  1.1 1  U    R.LIVHQTK.N
 3565   441.7406   881.4666   881.4607   6.79 0  23  0.039 1  U    K.DALDAIHK.Q
 3968   471.6197   1411.8373   1411.8286   6.14 1  27  0.0035 1  U    K.KIELTLPIETQK.T
 4096   553.9681   1658.8825   1658.8727   5.92 1  24  0.033 1  U    K.LNTSPSSIEDKDILK.L

18.   Q2UR52_ASPOR    Mass: 64720    Score: 34     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.05
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000967 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3576   446.7631   891.5116   891.5065   5.72 0  34  0.002 1  U    R.VLEYLQK.Y 3575

19.   Q2UK62_ASPOR    Mass: 75289    Score: 32     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.04
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3538   423.7392   845.4638   845.4606   3.78 1  32  0.01 1  U    K.LATEQKR.H
 4142   618.3440   1852.0102   1852.0054   2.59 1  1  3.9 1  U    R.SPNINAQIIQQQRLVK.F

20.   Q2UKB4_ASPOR    Mass: 91359    Score: 32     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.04
 Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3351   308.6882   615.3618   615.3592   4.37 0  (16) 0.62 3  U    K.ADIGIK.N
 3352   616.3700   615.3627   615.3592   5.79 0  32  0.017 1  U    K.ADIGIK.N

21.   Q2U0S3_ASPOR    Score: 32     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.03
 MaoC-like domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000326 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3296   507.2957   506.2884   506.2853   6.18 0  32  0.0032 1  U    K.VGGFK.T

22.   Q2U1V7_ASPOR    Mass: 35502    Score: 30     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.09
 ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3581   450.7508   899.4870   899.4937   -7.38 1  30  0.0084 1  U    K.RGANVNLR.D

23.   Q2UMK6_ASPOR    Score: 30     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.05
 WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000719 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3333   579.3172   578.3099   578.3064   6.07 0  30  0.017 1  U    K.IGDFK.S

24.   Q2UV06_ASPOR    Mass: 81360    Score: 30     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.04
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000100 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3351   308.6882   615.3618   615.3592   4.37 0  30  0.028 1  U    M.VGEIAK.L
 3569   443.7653   885.5160   885.5171   -1.19 0  0  11 1  U    R.KPLNISLT.-

25.   Q2TZC1_ASPOR    Mass: 56447    Score: 28     Matches: 2(2)  Sequences: 2(2)  emPAI: 0.12
 Serine hydroxymethyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000915 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3475   388.7211   775.4276   775.4228   6.22 0  23  0.044 1  U    R.LIDYPR.M
 3792   576.3273   1150.6400   1150.6346   4.74 0  25  0.019 1  U    K.LIIAGTSAYSR.L

26.   Q2TVX9_ASPOR    Mass: 84507    Score: 28     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Actin binding protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=Aoabp1 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3696   521.7643   1041.5140   1041.5342   -19.39 0  28  0.013 1  U    K.VTDPNTGLPK.S

27.   Q2UGJ5_ASPOR    Score: 27     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.06
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000818 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3549   432.7348   863.4550   863.4501   5.73 0  27  0.025 2  U    K.AGVLNFSR.E
 3813   594.3275   1186.6404   1186.6557   -12.89 1  2  9 3  U    R.VSSQQPSKVVK.S

28.   Q2U9Y9_ASPOR    Score: 27     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Terpene cyclase/mutase family member OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000611 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3315   525.3423   524.3350   524.3322   5.36 0  27  0.004 1  U    K.LPPAK.T

 
      Proteins matching the same set of peptides:
      Q2UF55_ASPOR    Score: 27     Matches: 1(1)  Sequences: 1(1)
29.   Q2UU93_ASPOR    Score: 27     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.08
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000407 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3315   525.3423   524.3350   524.3322   5.36 0  27  0.004 1  U    R.IPPAK.A

30.   Q2UCH1_ASPOR    Mass: 31180    Score: 26     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.11
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090012000591 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3681   510.2827   1018.5508   1018.5447   6.03 1  26  0.028 1  U    R.FASPNKNLK.R

31.   Q2U385_ASPOR    Mass: 32548    Score: 26     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.10
 RelA_SpoT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000141 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3599   459.7692   917.5238   917.5294   -6.06 1  26  0.016 1  U    R.SSGLISKAR.L
 3826   401.5373   1201.5901   1201.6051   -12.50 1  4  5.5 1  U    R.ERVQDALSQR.F

32.   PEPA_ASPOR    Score: 25     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.07
 Aspergillopepsin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pepA PE=1 SV=2
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3326   559.3844   558.3771   558.3741   5.44 0  25  0.0029 1  U    M.VILSK.V

33.   Q2UFH8_ASPOR    Mass: 137000   Score: 23     Matches: 2(0)  Sequences: 2(0)  emPAI: 0.02
 SF3b1 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090026000203 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3437   360.2280   718.4414   718.4377   5.16 0  0  1.8 4  U    K.GLAAFLK.A
 3896   652.3501   1302.6856   1302.6667   14.5 0  23  0.06 1  U    R.QVVDTTVDLGQK.V

34.   Q2U8D0_ASPOR    Mass: 26124    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.13
 CIA30 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000476 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3541   428.7579   855.5012   855.4967   5.35 0  23  0.027 1  U    R.LPLFGGPR.A

35.   Q2TWP0_ASPOR    Mass: 55369    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 ATP synthase subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000482 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3765   558.8275   1115.6404   1115.6339   5.89 0  23  0.041 1  U    K.VVDLLAPYAR.G

36.   Q2UQ81_ASPOR    Mass: 82237    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 AP complex subunit beta OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001357 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3493   400.7495   799.4844   799.4803   5.15 0  23  0.041 1  U    K.AIGQVAIK.I

37.   Q2UM83_ASPOR    Mass: 297757   Score: 23     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.01
 DRIM domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000101 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3326   559.3844   558.3771   558.3741   5.44 0  23  0.0055 2  U    R.LVSLK.I
 3626   473.7480   945.4814   945.4953   -14.68 0  12  0.9 1  U    K.QMALVQEK.I

38.   Q2TZM7_ASPOR    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.03
 DNA helicase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000793 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3326   559.3844   558.3771   558.3741   5.44 0  23  0.0055 2  U    K.LVSIK.G

39.   Q2U8V5_ASPOR    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.05
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000278 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3326   559.3844   558.3771   558.3741   5.42 0  23  0.0055 2  U    R.LVVTK.G

40.   Q2U267_ASPOR    Score: 22     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 Arrestin_N domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000582 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3326   559.3844   558.3771   558.3741   5.44 0  22  0.0059 5  U    R.ILVSK.T

 
      Proteins matching the same set of peptides:
      Q2UJ62_ASPOR    Score: 22     Matches: 1(1)  Sequences: 1(1)
41.   Q2UHE7_ASPOR    Mass: 73756    Score: 22     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000477 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3628   474.7714   947.5282   947.5440   -16.63 0  22  0.047 1  U    K.IDLLATFR.K

42.   Q2US03_ASPOR    Score: 22     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000620 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3541   428.7579   855.5012   855.5065   -6.19 0  22  0.038 2  U    K.LPLSVAQK.G

43.   Q2UHA9_ASPOR    Mass: 39464    Score: 21     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.08
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000518 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3752   549.8325   1097.6504   1097.6444   5.47 0  21  0.035 1  U    K.IPASDTLIIR.D

44.   Q2U9F0_ASPOR    Mass: 165829   Score: 18     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.02
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000055 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3372   321.7203   641.4260   641.4224   5.65 0  18  0.044 1  U    R.LLVAAR.I
 3491   399.7783   797.5420   797.5487   -8.33 1  7  0.22 2  U    R.GLVILRK.S

45.   Q2U724_ASPOR    Mass: 62067    Score: 15     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.05
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000001 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3886   643.3635   1284.7124   1284.7190   -5.10 1  15  0.23 1  U    K.AGKVLAYAIHDK.F

46.   Q2U984_ASPOR    Mass: 31060    Score: 15     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.11
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000133 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3476   389.2495   776.4844   776.4796   6.24 1  15  0.039 1  U    R.IIFEKK.D

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 3296
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 31.7    0.0032      6.18   21   Q2U0S3_ASPOR K.VGGFK.T
 16.9     0.096      6.24                     R.AAAFK.G
  8.2      0.72      6.18                     R.VFGGK.A
  2.0         3      6.24                     K.AFAAK.H
  0.5       4.3      6.24                     R.AAFAK.R
Top scoring peptide matches to query 3315
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.3     0.004      5.36   29   Q2UU93_ASPOR R.IPPAK.A
 27.3     0.004      5.36   28   Q2U9Y9_ASPOR LPPAK
 12.4      0.12      5.36                     K.LPAPK.S
Top scoring peptide matches to query 3326
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 25.4    0.0029      5.44   32   PEPA_ASPOR   M.VILSK.V
 22.6    0.0055      5.44   38   Q2TZM7_ASPOR K.LVSIK.G
 22.6    0.0055      5.44   37   Q2UM83_ASPOR R.LVSLK.I
 22.6    0.0055      5.42   39   Q2U8V5_ASPOR R.LVVTK.G
 22.3    0.0059      5.44   40   Q2U267_ASPOR ILVSK
  9.7      0.11      5.44                     VLSLK
  9.7      0.11      5.42                     K.VLTVK.L
  3.7      0.43      5.44                     R.ILSVK.G
  3.7      0.43      5.42                     R.ITVVK.L
  3.7      0.43      5.44                     K.LLSVK.F
Top scoring peptide matches to query 3333
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 29.7     0.017      6.07    1   IGF1_BOVIN   K.GIDFK.E
 29.7     0.017      6.07   23   Q2UMK6_ASPOR K.IGDFK.S
 11.7       1.1      6.10                     K.AVFNK.V
 11.7       1.1      6.10                     GLFNK
 11.7       1.1      6.07                     R.LGFDK.S
  8.4       2.3      6.07                     R.ADVFK.R
  8.4       2.3      0.27                     K.ATIMK.M
  8.4       2.3      6.07                     R.DAVFK.G
  8.4       2.3      6.07                     K.DLGFK.S
  8.4       2.3      6.07                     K.GQVFK.L
Top scoring peptide matches to query 3345
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 14.8      0.11      4.76    8   Q2U287_ASPOR R.FLPVK.T
  2.5       1.8      4.76                     R.FPIVK.L
  2.5       1.8      4.76                     R.FPLVK.Y
  1.9       2.1      11.4                     R.KGGTLK.D
Top scoring peptide matches to query 3351
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 27 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 29.5     0.028      4.37   24   Q2UV06_ASPOR M.VGEIAK.L
 17.1      0.49      4.39                     R.VNALAK.C
 16.1      0.62      4.37   20   Q2UKB4_ASPOR K.ADIGIK.N
 14.6      0.88    -13.86                     K.REIAK.D
 14.6      0.88    -13.86                     K.RELAK.D
 14.6      0.88    -13.86                     K.RQLAK.T
  9.2       3.1      4.39                     R.AGINLK.C
  9.2       3.1      4.39                     R.ANGILK.V
  8.9       3.2      4.39                     R.VINAAK.K
  8.9       3.2      4.37                     R.VQVAAK.L
Top scoring peptide matches to query 3352
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 27 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 31.9     0.017      5.79   20   Q2UKB4_ASPOR K.ADIGIK.N
 19.3      0.31      5.79                     K.IGEGLK.R
 19.3      0.31      5.79                     R.LGEGIK.W
 17.5      0.46      5.81                     R.ANGILK.V
 17.5      0.46      5.79                     K.QGGLLK.H
 17.5      0.46    -19.01                     R.WGLLK.A
 16.3      0.61      5.81                     R.ALNGLK.R
 13.7       1.1      5.79                     R.GELAVK.A
 13.7       1.1      5.79                     R.GQLIGK.G
 13.7       1.1      5.81                     K.NALAVK.D
Top scoring peptide matches to query 3368
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 26 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.6      0.11      4.46                     INNLR
 22.6      0.11      4.44    7   Q2U034_ASPOR K.LNDLR.S
 20.5      0.18      4.41                     R.IGGVER.C
 14.8      0.69      4.44                     AVGNLR
 13.1         1      4.44                     K.INEVR.Y
 13.1         1      4.46                     K.ININR.N
 13.1         1      4.46                     K.INLNR.T
 13.1         1      4.44                     INQVR
 13.1         1      4.44                     R.LNEVR.W
 13.1         1      4.44                     K.LNLDR.I
Top scoring peptide matches to query 3372
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.6     0.044      5.65   44   Q2U9F0_ASPOR LLVAAR
 13.2      0.12      5.65                     R.LGLLAR.L
 11.5      0.18      5.65                     R.IGALIR.I
 10.6      0.22      5.65                     R.IILQR.S
 10.6      0.22      5.65                     K.ILAIGR.L
 10.6      0.22      5.65                     K.ILGAIR.M
 10.6      0.22      5.65                     K.ILIQR.D
 10.6      0.22      5.65                     LIAGLR
 10.6      0.22      5.65                     K.LIGALR.A
 10.6      0.22      5.65                     R.LIIQR.K
Top scoring peptide matches to query 3385
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.4     0.076      4.94    8   Q2U287_ASPOR SDLYR
 17.4     0.076      4.97                     K.SNLYR.G
  6.3      0.98      4.94                     DSIYR
  4.8       1.4      4.94                     R.VSQYR.L
Top scoring peptide matches to query 3387
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.8    0.0012      4.20    1   IGF1_BOVIN   R.TIFFK.D
 15.8     0.038      4.20   15   Q2U8R9_ASPOR R.LTFFK.A
  3.0      0.72      4.20                     K.VYVFK.E
  3.0      0.72      4.20                     R.YVVFK.V
  0.9       1.2      4.20                     R.TFFIK.M
  0.2       1.4      10.4                     K.QPKPGK.F
Top scoring peptide matches to query 3388
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 35.0   0.00046      4.51    1   IGF1_BOVIN   R.TIFFK.D
 18.5      0.02      4.51   15   Q2U8R9_ASPOR R.LTFFK.A
  4.3      0.54      4.51                     K.VYVFK.E
  4.3      0.54      4.51                     R.YVVFK.V
  2.5      0.82      4.51                     R.TFFIK.M
  2.3      0.85     -6.50                     K.KGVSHK.G
  0.8       1.2      10.7                     K.QPKPGK.F
Top scoring peptide matches to query 3389
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.1    0.0014      5.39   15   Q2U8R9_ASPOR R.LTFFK.A
 30.1    0.0014      5.39    1   IGF1_BOVIN   R.TIFFK.D
  7.9      0.23      5.39                     K.VYVFK.E
  7.9      0.23      5.39                     R.YVVFK.V
Top scoring peptide matches to query 3394
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 37.6    0.0025      5.93   14   Q2U813_ASPOR R.ALLDAR.D
 37.6    0.0025      5.95   13   Q2U0N5_ASPOR R.ALLNAR.R
 22.9     0.075      5.93                     R.LAIDAR.A
 22.9     0.075      5.95                     LAINAR
 20.4      0.13    -17.28                     R.ALIWR.G
 20.4      0.13    -17.28                     ALLWR
 20.1      0.14      5.91                     R.ALGNGVK.D
 12.0      0.92      5.93                     IADLAR
 11.2       1.1      5.93                     K.AVQLAR.T
 11.2       1.1      5.93                     R.AVEIAR.R
Top scoring peptide matches to query 3417
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 26 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 14.9      0.66      4.77    3   Q2U2R5_ASPOR K.GTVADVK.C
 12.8       1.1      4.79                     R.AVSDAVK.K
  8.3         3      4.77                     R.TGADVVK.A
  7.5       3.6      4.81                     K.GNLSGLK.V
  7.3       3.8      4.81                     K.TAEAVAK.Q
  6.4       4.7      4.81                     K.KQGEVK.Q
  6.3       4.7      4.77                     K.GVTEGVK.E
  4.5       7.1      4.77                     K.DGVTVAK.A
  3.7       8.6      4.84                     K.QKANVK.D
  3.6       8.9      19.2                     K.AWSVAR.L
Top scoring peptide matches to query 3421
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 41.0   0.00042      5.34    3   Q2U2R5_ASPOR R.GLAVSPR.H
 12.5       0.3      5.34                     R.AVSGLPR.S
  6.7       1.1      5.37                     K.IKGEPR.R
  6.7       1.1      5.37                     K.IKGQPR.R
  6.7       1.1      5.34                     R.IQSVPR.D
  6.7       1.1      5.39                     R.KLANPR.Q
  1.0       4.2      5.37                     R.AVKPQR.V
  1.0       4.2      5.37                     R.GLPEKR.K
  1.0       4.2      5.37                     R.GLQPKR.L
  1.0       4.2      5.34                     R.IGSAPVR.A
Top scoring peptide matches to query 3430
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  1.1       8.5      6.27    3   Q2U2R5_ASPOR R.VWDMR.T
Top scoring peptide matches to query 3434
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.9     0.022      6.73   12   Q2UJR1_ASPOR R.VAWVLK.Q
 11.2      0.82      12.4                     R.VAQLRK.S
 11.0      0.87      12.4                     R.LGERLK.K
 11.0      0.87      12.4                     K.LGRELK.N
 10.9      0.88      12.4                     R.VAQAKAK.G
  6.8       2.3      2.03                     R.VPLMKK.Y
  5.8       2.9      2.03                     -.MKPVLK.Q
  5.0       3.5      12.4                     R.KEVIAR.M
  4.8       3.6      12.4                     R.VAEKLR.M
  4.8       3.6      12.4                     K.VALQKR.Y
Top scoring peptide matches to query 3437
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  6.7      0.43      5.16                     R.LAGAIFK.G
  3.0         1      0.48                     K.IMAKLK.E
  2.4       1.1      5.16                     R.ALFGLAK.A
  0.4       1.8      5.16   33   Q2UFH8_ASPOR K.GLAAFLK.A
  0.4       1.8      5.16                     R.IGLAFAK.I
Top scoring peptide matches to query 3441
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 14.1      0.31      4.62    8   Q2U287_ASPOR K.VSDFQK.H
Top scoring peptide matches to query 3475
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 23.4     0.044      6.22   25   Q2TZC1_ASPOR R.LIDYPR.M
  8.0       1.5      1.88                     K.ILMDLR.S
  8.0       1.5      6.24                     K.LIYPNR.E
  8.0       1.5      1.88                     K.LLQMVR.T
  7.9       1.6    -17.80                     R.LMPFLR.E
  4.7       3.2     -8.26                     R.LNLNFR.G
  0.6       8.3      19.0                     R.IGFHFR.F
  0.6       8.3      19.0                     K.LGFHFR.R
  0.6       8.3      19.8                     R.LGMQRR.K
  0.6       8.3     -3.08                     R.LGSRTSR.F
Top scoring peptide matches to query 3476
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 15.2     0.039      6.24   46   Q2U984_ASPOR R.IIFEKK.D
  0.0       1.3      6.23                     R.ILGSLFK.S
  0.0       1.3      6.24                     K.LLKFEK.F
Top scoring peptide matches to query 3483
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 26 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  3.7       8.9      5.17                     K.LSAAAEAR.S
  2.6        11      5.13    4   Q2UK92_ASPOR R.QLSSPTR.E
  0.9        17     -9.13                     K.AVATDRR.S
Top scoring peptide matches to query 3488
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  2.3       4.5      5.20    1   IGF1_BOVIN R.YPDHMK.Q
  0.2       7.2      0.92                   K.MHEVMK.K
Top scoring peptide matches to query 3489
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 14.2      0.29      5.20    1   IGF1_BOVIN R.YPDHMK.Q
Top scoring peptide matches to query 3491
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  7.6      0.17     -8.33                     K.LVGLIRK.H
  6.7      0.22     -8.33   44   Q2U9F0_ASPOR R.GLVILRK.S
  2.4      0.57     -8.33                     R.VAVKIIR.S
Top scoring peptide matches to query 3493
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.9     0.041      5.15   36   Q2UQ81_ASPOR K.AIGQVAIK.I
 16.3      0.18      5.15                     K.LADAIVAK.C
 13.0      0.39      5.17                     K.ALNLELK.S
  7.7       1.4     -8.88                     R.ALKQLAR.A
  7.6       1.4     -8.88                     R.AIQLARK.A
  7.5       1.4      5.15                     R.AIEILGGK.M
  7.0       1.6     -8.88                     K.IAALERK.W
  6.8       1.7     -8.92                     K.RVVDAIK.D
  6.8       1.7     -8.90                     K.NGAKLGLK.D
  6.7       1.7     -8.88                     R.AIRAIEK.E
Top scoring peptide matches to query 3508
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 47.9   0.00018      6.11    5   Q2UHF6_ASPOR K.VTLELGGK.S
 16.0      0.28      6.15                     R.LSILENK.L
 15.8      0.29     -7.64                     K.VITEAKR.R
 12.9      0.56     -7.62                     K.SILQAKR.V
  6.7       2.3     -7.64                     R.LSLSLQR.F
  6.7       2.3     -7.66                     K.TVLISQR.E
  4.7       3.7      6.15                     K.EALKVEK.E
  0.8       9.1     -7.64                     R.VTEALRK.E
  0.1        11     -7.62                     R.SLELRAK.D
  0.1        11     -7.62                     R.SLIKQAR.L
Top scoring peptide matches to query 3509
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.2     0.015      5.28    8   Q2U287_ASPOR R.FGGVPVIK.L
  0.6       5.5      1.19                     R.VLVNMLK.R
Top scoring peptide matches to query 3511
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  0.8       3.3      10.3                     R.NDCRPR.L
  0.8       3.3      5.33    4   Q2UK92_ASPOR K.WMNDPR.V
  0.7       3.4      19.1                     -.MNFYAR.A
Top scoring peptide matches to query 3513
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  7.8      0.83      6.10    8   Q2U287_ASPOR K.HIPSIPR.I
  7.6      0.87      19.8                     R.FAILEAR.N
  7.6      0.87      19.8                     K.FALLEAR.V
Top scoring peptide matches to query 3515
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 24.2     0.019      5.31    3   Q2U2R5_ASPOR R.NLAIHPR.E
  4.8       1.7      5.31                     K.INHLPAR.M
Top scoring peptide matches to query 3516
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 30.0     0.011      4.94    1   IGF1_BOVIN K.QHDFFK.S
  8.1       1.8     -2.18                   K.KDSQESK.T
  7.1       2.2    -11.22                   K.MTEPVTK.L
  6.2       2.7     -7.13                   R.DFPVDTK.I
  4.4       4.1    -11.20                   R.EVLDAMK.A
  2.0       7.2    -15.89                   K.QSKDTSR.K
  1.0       8.9      11.5                   R.TLDESQK.L
Top scoring peptide matches to query 3517
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 21.8     0.057      5.67    1   IGF1_BOVIN K.QHDFFK.S
 10.4      0.78     -6.36                   R.NDPISFK.R
  7.6       1.5     -6.40                   R.DFPVDTK.I
  7.0       1.7    -16.78                   K.RHSQHR.T
  3.5       3.8    -10.49                   K.MTEPVTK.L
  3.4       3.9    -10.47                   K.GLEQVMK.G
  3.3         4     -1.45                   K.KDSQESK.T
  3.2       4.1      1.58                   K.HQYMVK.D
Top scoring peptide matches to query 3520
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 26.5     0.015      4.65    1   IGF1_BOVIN K.FICTTGK.L
  8.1         1      4.67                   K.FICSATK.I
  1.0       5.1     -8.94                   K.TMVHPNK.Q
  0.7       5.5    -16.85                   R.SFSVTSAK.N
Top scoring peptide matches to query 3521
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 25.5     0.018      5.04    1   IGF1_BOVIN K.FICTTGK.L
  6.6       1.4      5.06                   K.FICSATK.I
  6.6       1.4      5.06                   R.MIQGSFK.S
  1.6       4.5      14.0                   R.EANVEHK.W
Top scoring peptide matches to query 3522
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 37.0    0.0013      5.53    1   IGF1_BOVIN K.FICTTGK.L
 14.9      0.21      5.54                   R.KMFGTDK.V
 14.7      0.22      5.54                   K.FICSATK.I
  7.8       1.1     -8.06                   K.TMVHPNK.Q
  5.6       1.8      5.54                   R.MIQGSFK.S
  4.4       2.4      1.48                   R.KMMTTAK.F
  3.7       2.8      14.5                   R.QLHGENK.A
  2.9       3.3     -8.06                   K.HQPGMLK.E
  2.0       4.1      9.63                   R.FGYNPTK.I
  1.3       4.7      9.63                   R.FGASGPYK.Q
Top scoring peptide matches to query 3531
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  2.0       1.1      4.32   17   Q2UPJ0_ASPOR R.LIVHQTK.N
Top scoring peptide matches to query 3533
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 50.4  5.6e-005      4.16    6   TRYP_PIG R.VATVSLPR.S
 12.0      0.39     -9.17                 R.ITRSIPR.E
 12.0      0.39     -9.17                 K.VDRIALR.R
  9.2      0.73      4.19                 K.LQKSLPR.Y
  5.2       1.8      17.5                 K.VLGTLPDK.G
  5.0       1.9      4.17                 K.LSLGLSPR.S
  4.8         2     -9.17                 R.VAVLERR.D
  4.1       2.4      4.16                 K.VSGTLPLR.F
  3.7       2.6      4.16                 K.GLAVLVDR.L
  1.9       3.9     -9.17                 K.VDIRALR.E
Top scoring peptide matches to query 3537
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.3     0.016      5.70    3   Q2U2R5_ASPOR R.LITGEADK.T
 18.3      0.26      5.71                     K.IITAENGK.A
 18.0      0.27      5.71                     R.LLASEEGK.K
  8.9       2.2     -7.59                     R.LLAASTDR.H
  8.6       2.4    -16.34                     R.ILVMDAGK.A
  8.6       2.4    -12.35                     K.LLDNFPK.K
  8.6       2.4      5.75                     R.LLNNNKK.E
  7.0       3.4     -4.63                     R.ILMQWR.T
  5.1       5.3     -7.59                     K.LDVRTNK.I
  4.7       5.9      17.4                     K.KPDAYPR.E
Top scoring peptide matches to query 3538
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 32.0      0.01      3.78   19   Q2UK62_ASPOR K.LATEQKR.H
  8.9       2.1      17.1                     R.IAKEEQK.E
  8.5       2.3      3.77                     K.LAKDGASGK.K
  6.4       3.7      17.1                     LAEEKEK
  6.4       3.7    -18.27                     R.LALSVMGR.M
  6.4       3.7      17.1                     R.LAQEKEK.A
  6.1         4      17.1                     R.ALETIGDK.T
  6.0       4.1      17.1                     R.ALTGDEIK.E
  6.0       4.1      3.75                     R.ALTGDLTR.D
  1.5        11      11.5                     R.IAARMQR.Y
Top scoring peptide matches to query 3541
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 23.0     0.027      5.35   34   Q2U8D0_ASPOR R.LPLFGGPR.A
 21.6     0.038     -6.19   42   Q2US03_ASPOR K.LPLSVAQK.G
  8.5      0.77     -6.19                     R.IPVAQLSK.R
  8.5      0.77      1.44                     K.LPNLLMR.E
  6.3       1.3    -19.32                     R.ILPTREK.G
  6.3       1.3    -19.34                     R.LLPGSTIR.G
  6.3       1.3    -19.34                     K.LLPTSGLR.V
Top scoring peptide matches to query 3547
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 37.3    0.0018      5.33    5   Q2UHF6_ASPOR K.LADLFER.D
 11.0      0.78      5.35                     K.IAFLNQR.I
 10.2      0.94      5.33                     R.GLQLFER.I
  2.4       5.6      5.33                     R.LAEGQFAK.E
Top scoring peptide matches to query 3549
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 63.3  6.2e-006      5.71    7   Q2U034_ASPOR R.AGDIVSFR.N
 27.3     0.025      5.73   27   Q2UGJ5_ASPOR K.AGVLNFSR.E
 14.4      0.49      5.71                     K.DQVLFSR.F
 14.4      0.49      1.84                     R.NKVLMSR.K
 13.8      0.56      5.71                     R.QDSVFLR.A
 10.2       1.3      13.3                     K.APRMAYR.V
  8.6       1.8      10.4                     R.AGTGSKSTR.N
  7.0       2.7      1.84                     R.AGLNMKSK.S
  2.9       6.9      14.8                     R.DKLTMEK.D
  0.7        11      5.73                     K.DAAVAVYR.E
Top scoring peptide matches to query 3558
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 49.3    0.0002      8.78    3   Q2U2R5_ASPOR R.LWDLAAGK.S
 11.9       1.1      13.4                     R.LANGLSAAR.L
 11.0       1.4      13.4                     R.LAREEQK.D
 10.8       1.4    -15.42                     K.EVAEKLGK.G
  9.9       1.7    -15.42                     R.LALQKDGK.D
  6.6       3.7    -15.42                     R.INASQVLK.S
  6.4       3.9      13.4                     R.LQGERAAK.S
  5.4       4.9      13.4                     R.AKQAEAQK.G
  5.3         5      13.4                     R.ERIQAQK.G
  4.9       5.4    -15.44                     R.ILSSPTGAK.T
Top scoring peptide matches to query 3565
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.7     0.039      6.79   17   Q2UPJ0_ASPOR K.DALDAIHK.Q
Top scoring peptide matches to query 3569
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  0.1        11     -1.19   24   Q2UV06_ASPOR R.KPLNISLT.-
Top scoring peptide matches to query 3575
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  7.7      0.83      5.48                     R.LVSQGLFK.V
  5.6       1.4     10.00                     R.ITSGSTKAK.V
  2.9       2.5     -7.10                     R.RFLSIQK.S
  2.9       2.5     -7.08                     K.YARIIQK.L
  1.1       3.8     -7.12                     K.LVKVDYR.A
  0.4       4.5      5.50   18   Q2UR52_ASPOR R.VLEYLQK.Y
  0.1       4.8      5.50                     R.KFLVEQK.E
Top scoring peptide matches to query 3576
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 33.9     0.002      5.72   18   Q2UR52_ASPOR R.VLEYLQK.Y
  8.3      0.72      5.71                     M.VLFESLGK.Q
  8.1      0.76      5.71                     K.VLGEFISK.R
  4.5       1.8     -6.87                     K.VQNKYLK.F
  4.3       1.8      5.72                     R.IYLDLQK.Q
Top scoring peptide matches to query 3578
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 35.4    0.0027      6.01   12   Q2UJR1_ASPOR K.LYDESIR.S
  8.7       1.3      6.01                     R.LYADAQSK.A
  7.5       1.7      18.6                     R.YLDDLQK.Q
  6.2       2.3      6.01                     R.QVYESLR.A
  2.1       5.9      18.6                     K.IENYVEK.S
  0.3       8.8     -6.54                     R.NRSVYEK.L
  0.3         9      1.51                     R.QFLPFNK.N
Top scoring peptide matches to query 3581
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.0    0.0084     -7.38   22   Q2U1V7_ASPOR K.RGANVNLR.D
 12.2       0.5    -15.62                     -.MRNVPVGK.E
 10.5      0.74      5.11                     K.RQQTIPR.Y
  9.3      0.97     -7.39                     K.RQDIVNR.F
  6.9       1.7     -7.38   22   Q2U1V7_ASPOR K.RGANVNLR.D
  5.6       2.3      0.61                     R.VEWPTLR.M
  5.6       2.3      17.6                     K.VTEDPALR.L
  5.3       2.5      5.11                     R.RQPLTER.I
  4.5         3     -7.41                     RGDVAVQR
  1.6       5.8      12.4                     K.RTMHSLR.E
Top scoring peptide matches to query 3591
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 11.4      0.53      17.4                     R.NSSAFVKR.E
 11.1      0.57     -7.32                     R.AIRHGAQR.I
 10.0      0.74      5.05    8   Q2U287_ASPOR R.QIEHLNR.T
  5.5       2.1      5.05                     R.HLQELNR.E
  5.1       2.3      5.05                     R.YLSSGRAR.H
  1.3       5.4      5.03                     R.GLALDHGAR.H
  0.8       6.2      17.4                     R.FASSVNRK.T
  0.6       6.4      17.4                     K.ETTFKQR.F
  0.5       6.6      17.4                     K.YSKDLQR.L
Top scoring peptide matches to query 3594
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.8    0.0066      5.61    9   Q2U480_ASPOR R.ALVINDGGR.E
  2.1       4.9      5.63                     K.ALSSPAVNR.L
  0.5       7.2      1.20                     R.FTTPALHK.I
  0.5       7.2      17.9                     K.NAPLSLNGK.T
Top scoring peptide matches to query 3599
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 25.6     0.016     -6.06   31   Q2U385_ASPOR R.SSGLISKAR.L
 10.4      0.52      6.19                     K.SSKQLDLK.H
 10.2      0.54      17.0                     R.SRTLWAGK.T
 10.2      0.54     -6.07                     R.STRGSIIGK.A
 10.2      0.54      6.19                     R.SVTGINKAK.T
  9.9      0.58      4.72                     R.AAFRQLGR.S
  9.6      0.62     -6.06                     K.SLRNSLTK.N
  8.6      0.78      18.4                     R.SEDLITLK.E
  4.4       2.1      18.4                     K.TELNSILK.R
  3.0       2.8      18.4                     R.SLLEIDTK.R
Top scoring peptide matches to query 3600
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 12.6      0.23      3.90    1   IGF1_BOVIN K.NGIKVNFK.I
Top scoring peptide matches to query 3601
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.6      0.19      5.18    1   IGF1_BOVIN K.NGIKVNFK.I
  0.4         4     -5.58                   R.KIESTLTK.Q
  0.3       4.1      5.18                   K.ARGVEFIK.V
Top scoring peptide matches to query 3602
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 26.5     0.017      4.22    1   IGF1_BOVIN K.NGIKVNFK.I
  9.5      0.84      4.22    1   IGF1_BOVIN K.NGIKVNFK.I
  4.0         3      4.22                   K.ERVELFK.A
  2.3       4.4      4.20                   R.VVKGENFK.I
  1.8       4.9     -8.01                   K.QGVGLYRK.F
Top scoring peptide matches to query 3603
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 17.0      0.14      5.52    1   IGF1_BOVIN K.NGIKVNFK.I
  3.2       3.4     -6.71                   K.QGVGLYRK.F
  0.7         6      5.52    1   IGF1_BOVIN K.NGIKVNFK.I
Top scoring peptide matches to query 3604
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 32.1    0.0044      5.60    1   IGF1_BOVIN K.NGIKVNFK.I
 14.3      0.26      5.60    1   IGF1_BOVIN K.NGIKVNFK.I
  8.3       1.1      5.60                   K.ERVELFK.A
  7.0       1.4      1.92                   K.GVGAKLMTK.G
  6.7       1.5     -6.63                   K.QGVGLYRK.F
  6.2       1.7      5.59                   R.VVKGENFK.I
  4.3       2.7      5.57                   R.QIGQTVFK.R
  1.0       5.7    -14.66                   R.LFMPLKR.L
Top scoring peptide matches to query 3605
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 18.2      0.11      6.26    1   IGF1_BOVIN K.NGIKVNFK.I
  7.5       1.3      6.26                   K.ERVELFK.A
  0.9       5.7      6.22                   R.QIGQTVFK.R
Top scoring peptide matches to query 3616
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 43.7   0.00057      5.58    4   Q2UK92_ASPOR R.VPYLPSQK.T
  8.7       1.8      9.91                     R.TIQSAGLNK.D
  2.7       7.2      1.96                     R.VGMAPLLSK.A
  1.4       9.7    -10.11                     K.TPIMIGKR.K
Top scoring peptide matches to query 3622
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 43.0   0.00052      6.38    3   Q2U2R5_ASPOR R.LDLLVTGGR.D
 18.2      0.16      6.43                     K.DLLINARK.E
  8.4       1.5      13.3                     -.MLPLARSR.I
  8.3       1.5      6.41                     K.LAVGLLNSR.R
  6.7       2.2      6.41                     R.IVEQGKLR.G
  6.5       2.3      18.3                     K.DILPTEKK.Y
  5.5       2.9      6.41                     R.LDRVALQK.Y
  4.3       3.9      6.44                     R.LNNAILKR.G
  2.8       5.4      6.41                     K.KVLEGQLR.G
Top scoring peptide matches to query 3626
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 12.4       0.9    -14.68   37   Q2UM83_ASPOR K.QMALVQEK.I
  9.3       1.8     -6.87                     R.VANTGSQLR.D
  3.0       7.7     -6.84                     R.AANADKSLR.G
  2.2       9.4      5.02                     K.QLEDKDAK.I
  1.2        12    -11.13                     K.SWTGALPSK.D
  0.6        14     -6.84                     R.AQQNLRSK.R
  0.6        14     -6.84                     R.AQQNLRSK.R
  0.6        14     -6.86                     R.RATNLDQK.S
  0.4        14      5.02                     R.ELNSDQLK.R
  0.0        16    -16.12                     K.CVGWLRR.N
Top scoring peptide matches to query 3628
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.7     0.047    -16.63   41   Q2UHE7_ASPOR K.IDLLATFR.K
 18.8     0.094      9.92                     R.LDLERFR.R
  8.3         1      9.92                     K.LIDFERR.R
  7.0       1.4     -1.96                     K.RGQVSVFR.S
  1.8       4.6      14.0                     K.LPMIQFAK.N
  0.4       6.4     -4.76                     R.EVIFAIQK.R
Top scoring peptide matches to query 3656
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 15.8      0.21      4.82    1   IGF1_BOVIN K.EDGNILGHK.L
Top scoring peptide matches to query 3657
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 53.6  3.5e-005      5.20    1   IGF1_BOVIN K.EDGNILGHK.L
Top scoring peptide matches to query 3666
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 11.2      0.62      6.14   10   Q2UPG4_ASPOR K.LIEAGMAHR.V
  1.7       5.5      13.5                     K.KSSPGQHTR.D
  1.7       5.5      13.6                     K.QNRAPAPSR.D
Top scoring peptide matches to query 3671
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 40.1   0.00016      6.03    8   Q2U287_ASPOR R.LLEIAQVPK.E
  9.4      0.18      19.8                     R.LQGRIVPAR.G
  1.6       1.1    -16.23                     R.ILAVSVRPR.G
Top scoring peptide matches to query 3681
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.0     0.028      6.03   30   Q2UCH1_ASPOR R.FASPNKNLK.R
 13.9      0.45      6.03   30   Q2UCH1_ASPOR R.FASPNKNLK.R
  8.4       1.6      6.00                     K.AFAIQVDVR.D
  6.7       2.4      9.95                     R.STTLRAGDAK.L
  3.4       5.1      2.70                     R.ASTIGLGMAAK.S
  3.2       5.3      17.0                     K.FAPLVEQSK.A
  1.6       7.8    -19.99                     R.WLAGRFAAK.E
  0.1        11      19.7                     R.FANEQVRR.Y
  0.1        11      16.3                     R.MARAVVSGGR.L
Top scoring peptide matches to query 3683
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 35.3    0.0024      5.77    5   Q2UHF6_ASPOR R.AAFEGEWSK.V
Top scoring peptide matches to query 3694
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 49.7   0.00011      6.17   11   Q2ULW0_ASPOR K.ASVDEYILK.Q
 13.1      0.51      6.18                     R.SANVLYELK.T
  1.2       7.9     -4.68                     K.TGNLQYTLK.R
Top scoring peptide matches to query 3696
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.5     0.013    -19.39   26   Q2TVX9_ASPOR K.VTDPNTGLPK.S
  7.4       1.3     -6.00                     K.ADEPDALRR.K
  4.4       2.6     -6.00                     R.LSLQSNHSR.S
  3.1       3.5     -6.00                     R.LSLQSNHSR.S
Top scoring peptide matches to query 3698
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 20.3      0.16      5.02    7   Q2U034_ASPOR R.HEAPPLQPR.Q
  3.1       8.2      15.8                     R.HELQGLYGK.N
Top scoring peptide matches to query 3703
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 58.0  2.4e-005      5.84    6   TRYP_PIG K.LSSPATLNSR.V
 15.4      0.43     -8.79                 K.LSSHFVSIR.K
  6.2       3.6      2.00                 R.LSELEWIR.G
  4.6       5.2     -1.23                 K.MSLELSPIR.V
  0.9        12     -1.25                 R.LDEMVAVIR.D
Top scoring peptide matches to query 3709
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 45.9   0.00026      5.36    8   Q2U287_ASPOR K.TCSDLLLVK.S
  1.9       6.5      18.0                     R.EWFQVLAR.G
  0.3       9.3      12.5                     K.SLAKNSNSVK.T
Top scoring peptide matches to query 3712
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 62.4  8.5e-006      5.21    1   IGF1_BOVIN K.FEGDTLVNR.I
 10.9       1.2     -5.49                   R.FEVETGGRR.W
  8.5       2.1      15.9                   R.FDDAVNIQK.V
  6.1       3.6    -18.75                   R.FTEQVGLEK.E
  5.7       3.9      14.6                   R.FAGAGPGGFGGR.G
  5.6         4    -18.75                   K.AVYDVIGEGK.T
  5.5       4.1     -5.46                   K.FEESRNLR.K
  5.3       4.3      12.7                   R.MEKVLDNGK.T
  5.3       4.3     -8.68                   -.MEQTTRIR.K
  4.5       5.2      15.9                   R.FDDAVNIQK.V
Top scoring peptide matches to query 3713
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 40.0    0.0015      5.79    1   IGF1_BOVIN K.FEGDTLVNR.I
 12.5      0.83     -4.91                   R.FEVETGGRR.W
  9.6       1.6      16.5                   R.FDDAVNIQK.V
  7.8       2.4    -18.17                   R.FTEQVGLEK.E
  6.3       3.4      16.5                   R.FDDAVNIQK.V
  2.0       9.4     -4.89                   K.YLNGKGNGAR.Y
  1.7       9.9      13.3                   R.MEKVLDNGK.T
  1.4        11     -4.89                   K.FEESRNLR.K
  1.4        11     -8.11                   -.MEQTTRIR.K
  1.0        12      5.83                   R.EFNNRLAGK.D
Top scoring peptide matches to query 3717
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 47.2   0.00026      5.97    5   Q2UHF6_ASPOR K.GDVAAAAGCLR.Y
 18.7      0.18      16.6                     R.MNLENVAPR.L
 10.9       1.1    -14.58                     R.GLTAIWEDR.Q
  9.9       1.4    -10.79                     K.VDKVNGSADR.K
  7.5       2.4     -4.60                     R.AAMASRNAPR.L
  7.5       2.4    -14.57                     R.FIAEQEAPR.R
  7.5       2.4      9.17                     K.FRPSNDAPR.E
  7.5       2.4      16.6                     R.MNLENVAPR.L
  1.1        11     -1.46                     R.GPNGPTQHPR.L
Top scoring peptide matches to query 3721
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 16.0      0.12      6.25   12   Q2UJR1_ASPOR R.TITYGELLR.E
Top scoring peptide matches to query 3726
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 41.2    0.0013      6.99    4   Q2UK92_ASPOR R.TETVMLEPR.V
  2.7       8.8     -9.52                     K.QTTLNIVQR.K
  2.1        10     -9.55                     K.TDDVLSGAAVK.G
  1.6        11      13.9                     K.SDISELQQR.L
  1.5        12     -9.54                     R.ETTKQSVGPK.E
  0.6        14      13.9                     K.SENAELQKR.Y
  0.2        16    -13.91                     K.AVQNTMRQK.G
Top scoring peptide matches to query 3727
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.7     0.032      4.02   11   Q2ULW0_ASPOR K.YGPQEAEKR.E
 11.8      0.98     -9.57                     K.DVRMGGASIR.N
 11.4       1.1      18.2                     M.DTTSNEAAIR.L
 10.4       1.3      4.01                     K.STSAWGLEAR.V
 10.0       1.5      11.3                     K.DEVMVLAER.V
  7.2       2.8      4.02                     K.TPNYENIAR.L
  7.0         3      7.75                     K.GSSEAKNTGAR.R
  6.5       3.4      4.02                     K.APRSYGSPNK.L
  6.4       3.4      0.86                     K.GSVANMSLGGGK.S
  6.0       3.7      0.89                     R.AQNMLKGGNK.E
Top scoring peptide matches to query 3732
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 37.0    0.0014      4.80    9   Q2U480_ASPOR R.YLGVDLFTR.Q
  8.6      0.99     -5.53                     K.YILYARER.C
  8.6      0.99     -5.53                     K.YLYEIARR.H
  0.7       6.2      4.80                     K.DVGYITFLR.Q
  0.2         7     -5.56                     K.ERFVYTLR.Q
  0.0       7.2      17.7                     R.YAGYANRLR.T
Top scoring peptide matches to query 3736
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  6.7         3      15.7                     K.EVQAIQEAAK.R
  5.5       3.9    -17.72   11   Q2ULW0_ASPOR R.ELAQAKNLAK.A
  4.9       4.5     -8.66                     K.QAKDVYVHK.I
  1.7       9.5      15.7                     K.EVQAIQEAAK.R
  1.4        10      15.7                     R.ALVDLNANEK.A
  1.4        10      5.39                     R.ELRVEADQK.R
  0.5        12      5.41                     R.AERLDGINAK.S
  0.5        12      5.41                     R.IVNEEQRAK.I
  0.5        12    -17.75                     K.QGGLQALLASK.Q
Top scoring peptide matches to query 3745
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 13.4      0.71      5.31    4   Q2UK92_ASPOR R.TETVMLEPR.V
Top scoring peptide matches to query 3752
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.4     0.035      5.47   43   Q2UHA9_ASPOR K.IPASDTLIIR.D
Top scoring peptide matches to query 3760
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 50.3  9.4e-005      5.56    3   Q2U2R5_ASPOR K.IWNLATGALR.L
 15.0      0.32      5.57                     R.IWIREQLR.H
 15.0      0.32      15.7                     R.HIYIAIDAAK.S
 13.1       0.5     -3.33                     R.SLVILDELGR.G
 13.1       0.5      1.96                     R.WLLLNIWR.Q
  7.6       1.8      15.7                     R.IWNIIQGLR.T
  6.3       2.3      9.16                     K.IQGVLNTGRR.M
  3.0       5.1    -13.44                     R.GTILVGGKDVR.E
  2.0       6.3      9.16                     K.SAVDRVAQLR.L
  1.9       6.6      19.2                     K.LADGSVPRATK.F
Top scoring peptide matches to query 3765
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.9     0.041      5.89   35   Q2TWP0_ASPOR K.VVDLLAPYAR.G
  7.8       1.4     -0.57                     K.TSLLNSVARR.L
  5.4       2.3      19.6                     K.QATILEALTR.K
Top scoring peptide matches to query 3766
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.0      0.02      5.36   12   Q2UJR1_ASPOR K.VVITTDEGKR.G
  0.8       8.4    -17.14                     R.EIATVKSELK.Y
  0.8       8.4      5.38                     K.ERTEITQLK.Q
  0.7       8.6    -11.89                     R.YFSLIHPLK.Y
Top scoring peptide matches to query 3772
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.9    0.0045      4.80    5   Q2UHF6_ASPOR K.IAFTGSTLVGR.M
  7.9      0.89    -17.63                     K.LAFVSLLSGSK.S
  4.8       1.8     -8.80                     R.ALFPKFSVGR.V
  0.7       4.7      17.7                     R.ALMINIMKR.N
Top scoring peptide matches to query 3774
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 11.5      0.28     -0.85    3   Q2U2R5_ASPOR R.VISGHLGWVR.S
Top scoring peptide matches to query 3780
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 70.2  8.7e-007      5.93    7   Q2U034_ASPOR R.NPSDATLEQR.H
Top scoring peptide matches to query 3785
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 45.0   0.00042      6.76    2   FHP_YEAST R.QENQYDALR.H
  8.6       1.8      16.7                  R.ADAEQFLANR.E
  1.6       9.2    -11.88                  K.VTGTGANSVSSR.S
  1.5       9.4      6.75                  R.KDQGANNFDK.D
  0.8        11      6.75                  K.KQSGGPGDYAR.V
  0.3        12      6.76                  R.VYNRQPDSR.Y
  0.3        12     -3.13                  R.RDVENAYNR.A
Top scoring peptide matches to query 3792
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 24.6     0.019      4.74   25   Q2TZC1_ASPOR K.LIIAGTSAYSR.L
  3.2       2.7     -5.01                     K.ILLKHANEGR.R
  0.4       5.1      14.5                     K.IIIYDSKGNK.L
Top scoring peptide matches to query 3793
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.3      0.08      6.40    5   Q2UHF6_ASPOR R.ILVQEGIHDK.F
  7.4      0.99      6.41                     R.VKNILFSSSR.F
Top scoring peptide matches to query 3795
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 16.8      0.22      5.64    2   FHP_YEAST R.HYSLCSASTK.N
  0.4       9.9      12.5                  R.MAETNPKMAK.E
Top scoring peptide matches to query 3813
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  3.9       5.4      0.96                     R.CLLAYHRVR.T
  3.7       5.7      8.34                     K.SADQLINAARK.S
  1.7         9    -12.89   27   Q2UGJ5_ASPOR R.VSSQQPSKVVK.S
  1.7         9    -12.89   27   Q2UGJ5_ASPOR R.VSSQQPSKVVK.S
Top scoring peptide matches to query 3814
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 29.4    0.0055      6.52    3   Q2U2R5_ASPOR R.LITGEADKTIK.V
  5.5       1.3     -6.32                     K.LIPQLLNSYK.K
  1.7       3.2      18.2                     R.KSGASSAIQAIR.D
Top scoring peptide matches to query 3816
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 14.1     0.039      7.16    8   Q2U287_ASPOR R.IIKDSLLPAPK.S
Top scoring peptide matches to query 3817
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.7      0.18      5.45   12   Q2UJR1_ASPOR R.LNAAYNCVDR.H
Top scoring peptide matches to query 3819
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 29.6    0.0049      4.30    3   Q2U2R5_ASPOR R.LTLTGHISTVR.G
Top scoring peptide matches to query 3826
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  4.3       5.5    -12.50   31   Q2U385_ASPOR R.ERVQDALSQR.F
  2.5       8.1      17.8                     K.QEQEQKQQR.L
Top scoring peptide matches to query 3827
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 40.9   0.00096      5.30   10   Q2UPG4_ASPOR K.FSGCLYGPFR.D
  2.1       7.4     -9.43                     K.SKWYYTAQR.K
  0.1        12    -15.43                     R.DQAWRNQASK.K
Top scoring peptide matches to query 3830
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 61.6    1e-005      4.93    2   FHP_YEAST K.LSAPAGDFAINK.E
  9.6       1.6      11.5                  K.SALPLVQQMSK.D
  6.7       3.2      17.6                  K.LSAKLDAQNNK.H
  1.9       9.6      2.15                  R.RNQIMVLEAK.I
Top scoring peptide matches to query 3831
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 39.3     0.001      5.53    9   Q2U480_ASPOR R.ISVSPQTGQHR.Y
  7.6       1.5    -10.39                     R.LWIAWHNLR.E
  2.3         5    -15.28                     R.EAVTVVHEVAR.R
Top scoring peptide matches to query 3838
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 35.7    0.0036    -11.82   16   Q2UU14_ASPOR K.NKTNVEVDAAR.D
 20.1      0.13    -11.84                     R.DQTTLEAVGER.L
  9.0       1.7      18.0                     K.EAGVDVSEQER.F
  9.0       1.7    -11.82                     R.QQVEETAKER.L
  9.0       1.7    -11.82                     R.QQVEETAKER.L
  7.4       2.4     -6.45                     R.ELNRCLEER.Q
  7.3       2.5      8.82                     R.QVRTGDQAGQR.Q
  7.2       2.5    -11.82                     R.ALSQTDANLQR.G
  5.7       3.6     -3.70                     R.EQWSERIDR.E
  4.8       4.3     -6.47                     -.MVDRADNQLR.E
Top scoring peptide matches to query 3848
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  4.5       4.6      5.96   12   Q2UJR1_ASPOR R.TGTEVPWTQGR.D
Top scoring peptide matches to query 3872
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 18.6      0.14      5.08    1   IGF1_BOVIN K.SAMPEGYVQER.T
  2.9       5.2     -8.95                   K.TAQGVQNLYDR.M
  1.4       7.4      16.1                   R.QGHELGNHAMR.D
Top scoring peptide matches to query 3873
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 64.4  3.7e-006      5.56    1   IGF1_BOVIN K.SAMPEGYVQER.T
  8.2       1.5    -17.35                   K.GQPANKPDADPR.H
  1.1       7.7    -17.35                   K.GQPANKPDADPR.H
  1.1       7.9      17.6                   K.TIDSVSGNMANR.T
  0.2       9.6      16.6                   R.QGHELGNHAMR.D
Top scoring peptide matches to query 3882
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 57.9  1.4e-005      5.08    1   IGF1_BOVIN K.SAMPEGYVQER.T
  6.9       1.8    -12.10                   R.LMQTVVCQMR.F
  1.5       6.2     -1.05                   R.QEHPSNWDLR.Q
  1.5       6.2     -1.05                   R.QEHPSNWDLR.Q
  0.6       7.7     -6.82                   K.SSMFQKWDPR.A
  0.1       8.7    -12.10                   R.LMQTVVCQMR.F
Top scoring peptide matches to query 3883
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 22.1     0.057      5.86    1   IGF1_BOVIN K.SAMPEGYVQER.T
Top scoring peptide matches to query 3886
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 15.2      0.23     -5.10   45   Q2U724_ASPOR K.AGKVLAYAIHDK.F
  0.1       7.8    -12.79                     R.EILPSSLLQSAK.N
Top scoring peptide matches to query 3896
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 23.4      0.06      14.5   33   Q2UFH8_ASPOR R.QVVDTTVDLGQK.V
  2.5       7.3      16.5                     R.DPTKIVWNMAK.L
Top scoring peptide matches to query 3912
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 44.8  3.3e-005      4.65    5   Q2UHF6_ASPOR K.IGPAIAAGNVVVLK.T
Top scoring peptide matches to query 3918
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 43.8   0.00062      3.03    4   Q2UK92_ASPOR R.LGQLIGGAGNYDR.G
Top scoring peptide matches to query 3921
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 56.9  2.8e-005      6.47    3   Q2U2R5_ASPOR R.EFTFASASTGSIK.Q
  0.8        11    -10.23                     R.FTEGKQSHNGIK.D
  0.8        11     -2.87                     R.RPRSWYISHGS.-
Top scoring peptide matches to query 3922
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 58.1  2.2e-005      5.04    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  0.3        14     -2.79                   R.EGMLAEQERLR.A
Top scoring peptide matches to query 3923
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 51.1   0.00011      5.28    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  3.2       6.9     -2.55                   R.EGMLAEQERLR.A
  1.2        11    -12.91                   R.TASLCQEITVPK.T
  0.6        13      19.6                   K.QGGGSETSALPTNK.D
  0.6        13      8.28                   K.WDNLDSAALNTK.Y
Top scoring peptide matches to query 3924
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 64.6    5e-006      5.48    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  1.9       9.3     -2.35                   R.EGMLAEQERLR.A
  0.6        12      19.8                   K.QGGGSETSALPTNK.D
  0.6        12      8.48                   K.WDNLDSAALNTK.Y
Top scoring peptide matches to query 3925
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 37.8    0.0023      5.72    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  3.1       6.7     -2.11                   R.EGMLAEQERLR.A
  0.9        11    -12.46                   R.TASLCQEITVPK.T
  0.4        13      8.73                   K.WDNLDSAALNTK.Y
Top scoring peptide matches to query 3931
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.6     0.013      4.56    3   Q2U2R5_ASPOR R.HPYLFSCGEDK.M
Top scoring peptide matches to query 3968
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.2    0.0035      6.14   17   Q2UPJ0_ASPOR K.KIELTLPIETQK.T
Top scoring peptide matches to query 3969
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 38.4    0.0015      5.93    4   Q2UK92_ASPOR R.GIHLLVGEQEYR.G
  1.4       7.3      15.8                     K.RAYLEVHGAGAGGR.A
Top scoring peptide matches to query 3970
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 52.5  6.9e-005      5.34    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
  0.4        11      5.93                   R.NVEVGPSSFDKIK.L
Top scoring peptide matches to query 3971
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 60.8    1e-005      5.40    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
  0.7        10      15.8                   K.LENAAERGTVGFR.S
Top scoring peptide matches to query 3973
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 16.3      0.32      5.75    8   Q2U287_ASPOR R.LEHGQLVMDPNR.F
  2.2       8.2    -11.90                     K.IQFSQQELMKR.W
  2.1       8.3      9.06                     K.EKQYDLDTGVQK.F
  1.6       9.2    -11.90                     K.IQFSQQELMKR.W
  1.6       9.2    -11.90                     K.IQFSQQELMKR.W
  1.0        11    -14.61                     K.QKHIGGNSDLQAR.K
  1.0        11     -4.03                     R.QSMSPIIFSNVGK.R
Top scoring peptide matches to query 3977
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 49.5   0.00016      5.25    4   Q2UK92_ASPOR R.YIPSVGQYLSFR.V
  4.1       5.6     -6.71                     R.IATSNSKAPVTPSR.C
Top scoring peptide matches to query 3983
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 34.5     0.004      5.11    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
  4.4         4      2.42                   R.FLELDTQQRMR.L
  4.4         4    -19.65                   R.FTLLGSVESLQDK.W
Top scoring peptide matches to query 3984
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 44.1   0.00045      6.66    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
Top scoring peptide matches to query 3988
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 53.6    5e-005      5.50    5   Q2UHF6_ASPOR K.TAEQTPLSGLYAAK.L
Top scoring peptide matches to query 3996
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 36.6   0.00025      5.76   10   Q2UPG4_ASPOR R.SVILFGVPLHPSAK.D
Top scoring peptide matches to query 4002
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 67.7  2.3e-006      4.74    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
  6.8       2.8      19.5                   R.TVGGLTARDQMVGR.W
  6.1       3.2      16.8                   R.VTLMNWGNAIVSR.I
  0.4        12      17.7                   K.LSVDELIDAMDLK.S
Top scoring peptide matches to query 4003
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 39.0    0.0016      5.55    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
  0.0        13      14.9                   K.HAFSMIAELFAPK.S
Top scoring peptide matches to query 4004
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 59.0  1.6e-005      5.70    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
Top scoring peptide matches to query 4005
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 62.2  7.4e-006      6.31    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
  1.6       8.4      10.7                   -.MTPQTKSYRPPR.R
  0.7        10      18.3                   R.VTLMNWGNAIVSR.I
Top scoring peptide matches to query 4006
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 40.5    0.0011      6.72    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
 10.6       1.1      16.2                   R.QNLAKGINHNNPR.T
 10.6       1.1      16.2                   R.QNLAKGINHNNPR.T
 10.6       1.1      16.2                   R.QNLAKGINHNNPR.T
 10.6       1.1      16.2                   R.QNLAKGINHNNPR.T
  3.7       5.2      16.2                   K.TPRSQHGPNLNVR.S
  1.3         9      16.2                   R.QNLAKGINHNNPR.T
  1.3         9      16.2                   R.QNLAKGINHNNPR.T
  1.1       9.5      11.2                   R.IREVFGLMQNNR.A
  1.1       9.5      11.2                   R.IREVFGLMQNNR.A
Top scoring peptide matches to query 4010
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  4.0       6.1      5.07    9   Q2U480_ASPOR R.SADTVPIPCNFIR.I
Top scoring peptide matches to query 4012
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 47.3    0.0002      6.64    2   FHP_YEAST K.NIDDLSVLMDHVK.Q
  3.4         5    -17.65                  -.MATQLVPLPEVER.L
  2.5       6.1    -12.71                  R.ITGQDIIDRVNPR.Y
  1.0       8.6      1.40                  R.DKVLADNLGPNWR.D
Top scoring peptide matches to query 4013
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 11.3      0.43      7.15    9   Q2U480_ASPOR K.QGIPVVPQGELFSK.I
Top scoring peptide matches to query 4015
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 75.8  1.8e-007      4.47    1   IGF1_BOVIN K.FSVSGEGEGDATYGK.L
  2.1       4.3      14.1                   K.GMESQLERNMYK.L
Top scoring peptide matches to query 4016
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 41.7   0.00049      5.01    1   IGF1_BOVIN K.FSVSGEGEGDATYGK.L
  0.8       6.1      14.6                   K.GMESQLERNMYK.L
  0.4       6.6    -12.18                   -.MSAGGEHLKDEGTR.R
Top scoring peptide matches to query 4017
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
110.8  6.2e-011      5.14    1   IGF1_BOVIN K.FSVSGEGEGDATYGK.L
  2.6       4.1    -12.04                   -.MSAGGEHLKDEGTR.R
Top scoring peptide matches to query 4022
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 13.0      0.69      5.11    2   FHP_YEAST K.NIDDLSVLMDHVK.Q
Top scoring peptide matches to query 4031
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 39.2   0.00092      5.09    1   IGF1_BOVIN K.FEGDTLVNRIELK.G
  0.8       6.4      10.2                   R.VCELTAKIETLEK.E
Top scoring peptide matches to query 4032
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 20.1     0.071      6.02    1   IGF1_BOVIN K.FEGDTLVNRIELK.G
Top scoring peptide matches to query 4038
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  1.9       8.4      4.05    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
Top scoring peptide matches to query 4039
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 26.9     0.026      4.60    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
  3.2       6.1      17.0                   R.DQLASMQPSIIPPK.R
Top scoring peptide matches to query 4040
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 50.9   0.00011      4.85    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
Top scoring peptide matches to query 4041
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  9.3       1.5      5.38    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
  1.2       9.8      17.8                   R.DQLASMQPSIIPPK.R
Top scoring peptide matches to query 4042
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.7      0.55      5.38    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
 12.1       0.8      17.8                   R.DQLASMQPSIIPPK.R
  0.9        11     -8.33                   R.GVSPLTQAQISEGVR.T
  0.9        11     -8.33                   R.GVSPLTQAQISEGVR.T
Top scoring peptide matches to query 4043
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 55.7  3.4e-005      5.63    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
  1.7       8.6      18.0                   R.DQLASMQPSIIPPK.R
  0.4        12     -3.83                   K.GLMAGAKNPIAAEQR.R
Top scoring peptide matches to query 4044
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 38.4    0.0019      5.82    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
  1.5       9.3     -7.89                   R.GVSPLTQAQISEGVR.T
Top scoring peptide matches to query 4047
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 57.4  1.4e-005      3.89    1   IGF1_BOVIN R.APQTGIVDECCFR.S
Top scoring peptide matches to query 4048
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 15.0      0.24      4.29    1   IGF1_BOVIN R.APQTGIVDECCFR.S
Top scoring peptide matches to query 4058
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 19.2      0.16      3.20   12   Q2UJR1_ASPOR K.VAIIYEADEPNEGR.T
  5.0       4.3      16.6                     R.TAGIWGDWENALDK.N
  4.7       4.6    -19.92                     R.ITEGNVSQWGEVKK.K
  0.6        12      14.5                     -.MIPDVYAPQNVNGR.Y
  0.6        12      14.5                     -.MIPDVYAPQNVNGR.Y
  0.2        13    -19.92                     K.IEGPASGEDVLVAYR.S
  0.1        13      4.77                     R.NTPFGWGVLAMPQR.G
Top scoring peptide matches to query 4060
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 19.0      0.13      3.56    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
  4.0         4      13.2                   K.EMRILMLGLDNAGK.T
  2.7       5.4      13.2                   K.EMRILMLGLDNAGK.T
Top scoring peptide matches to query 4061
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 23.6     0.045      5.33    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
  1.7         7      15.0                   K.EMRILMLGLDNAGK.T
  0.3       9.7      15.0                   K.EMRILMLGLDNAGK.T
Top scoring peptide matches to query 4062
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 32.9    0.0052      5.76    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4068
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 34.4    0.0043      5.63    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4069
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 25.9     0.031      5.71    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4070
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  5.1       3.5      6.46    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4071
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 25.8     0.029      6.76    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4073
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 14.1     0.099      5.60    2   FHP_YEAST K.VGAQPNALATTVLAAAK.N
Top scoring peptide matches to query 4074
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 63.2  1.2e-006      5.65    2   FHP_YEAST K.VGAQPNALATTVLAAAK.N
Top scoring peptide matches to query 4075
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 14.9      0.43      5.92    2   FHP_YEAST R.ENFPAGLVSEYLHK.D
  1.5       9.6     -7.26                  R.ESFALNLVENPLTR.S
Top scoring peptide matches to query 4076
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.2      0.44      3.85    1   IGF1_BOVIN R.YPDHMKQHDFFK.S
  1.4       6.6      17.9                   R.VSHHSTSDDSFAYR.A
Top scoring peptide matches to query 4080
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  7.7       1.9      16.8    1   IGF1_BOVIN R.YPDHMKQHDFFK.S
Top scoring peptide matches to query 4081
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 12.6      0.62      17.5    1   IGF1_BOVIN R.YPDHMKQHDFFK.S
Top scoring peptide matches to query 4082
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 55.5  1.2e-005      5.13    2   FHP_YEAST K.ATVPVLEQQGTVITR.T
Top scoring peptide matches to query 4083
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 22.2     0.025      6.57    2   FHP_YEAST K.ATVPVLEQQGTVITR.T
Top scoring peptide matches to query 4085
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 20 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 57.1  2.6e-005      5.52    7   Q2U034_ASPOR R.QDQLENAHLQIGTR.I
  4.0       5.3      17.3                     -.MGSTQLAQTLLQSAR.V
  0.1        13     -8.44                     R.WLKPEPGKIHDMR.R
  0.1        13      3.45                     R.MAAAGSRTSSISSKPR.F
Top scoring peptide matches to query 4096
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 24.4     0.033      5.92   17   Q2UPJ0_ASPOR K.LNTSPSSIEDKDILK.L
Top scoring peptide matches to query 4100
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 47.6    0.0002      4.97    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
  2.3       6.8     -0.96                   K.WLQQAQDNKTFSIS.-
  1.0       9.1     -0.96                   K.WLQQAQDNKTFSIS.-
  1.0       9.1     -0.96                   K.WLQQAQDNKTFSIS.-
Top scoring peptide matches to query 4101
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 32.8    0.0064      6.48    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
  3.3       5.8      0.56                   K.WLQQAQDNKTFSIS.-
  2.4       7.1    -19.67                   R.AGNTGIATAFFNRGNR.G
  2.4       7.1    -19.67                   R.AGNTGIATAFFNRGNR.G
Top scoring peptide matches to query 4103
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 25.6     0.031      14.4    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
  3.1       5.4    -11.74                   R.AGNTGIATAFFNRGNR.G
  3.1       5.4    -11.74                   R.AGNTGIATAFFNRGNR.G
Top scoring peptide matches to query 4113
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 11.9      0.75      4.06    1   IGF1_BOVIN R.RAPQTGIVDECCFR.S
  1.9       7.5     -3.56                   M.TSETAPSPNYDKELR.I
Top scoring peptide matches to query 4114
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 39.4    0.0014      5.65    1   IGF1_BOVIN R.RAPQTGIVDECCFR.S
  8.0       1.9    -15.11                   K.APQRASSYSSALEEGR.M
  0.9       9.8     -1.96                   M.TSETAPSPNYDKELR.I
Top scoring peptide matches to query 4141
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.2      0.03      16.7    9   Q2U480_ASPOR R.IGDILILQGRPCQVIR.I
 17.2      0.03      16.7    9   Q2U480_ASPOR R.IGDILILQGRPCQVIR.I
  3.6      0.67      4.90                     K.IGTNVALLNGLQHLLFK.N
Top scoring peptide matches to query 4142
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 13 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  1.4       3.9      2.59   19   Q2UK62_ASPOR R.SPNINAQIIQQQRLVK.F
  0.9       4.5     -7.49                     R.AIGGIGVGTLAMISPPNLR.G
Top scoring peptide matches to query 4144
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 30.9     0.011      15.5    2   FHP_YEAST K.NMLTEHTELLNIFNR.T
 16.6      0.31      15.5    2   FHP_YEAST K.NMLTEHTELLNIFNR.T
  4.6       4.8      15.5    2   FHP_YEAST K.NMLTEHTELLNIFNR.T
  1.2        11     -6.15                  R.SNSFVNASVNVSPDRLR.Q
Top scoring peptide matches to query 4151
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 13.3      0.12      5.86    2   FHP_YEAST K.IIVHTDTEPLINAAFLK.E
  2.3       1.5      4.08                  -.MNLHLLTIPILIETTR.Q
Top scoring peptide matches to query 4155
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 24.9     0.043      15.1    3   Q2U2R5_ASPOR R.SLAVEPNNEWFASGAGDR.T
 24.9     0.043      15.1    3   Q2U2R5_ASPOR R.SLAVEPNNEWFASGAGDR.T
Top scoring peptide matches to query 4171
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 18 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  5.3       2.7      3.74    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
Top scoring peptide matches to query 4172
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 50.1  9.3e-005      5.58    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
  0.2       9.1      14.9                   K.LTMNDMMALFGRDAESR.F
Top scoring peptide matches to query 4173
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 24.3     0.032      7.40    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
 24.3     0.032      7.40    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
 14.4      0.31      7.40    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
Top scoring peptide matches to query 4177
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 46.8   0.00021      15.1    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
 39.1    0.0013      15.1    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
 26.2     0.024      15.1    1   IGF1_BOVIN K.LEYNYNSHNVYIMADK.Q
Top scoring peptide matches to query 4180
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  2.7       2.3      15.1    4   Q2UK92_ASPOR R.HPIRPKPPHQGDVFYIR.Y
Top scoring peptide matches to query 4183
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 65.8  3.2e-006      5.76    4   Q2UK92_ASPOR R.VSAAWGEAGPISHQEEFLR.N
Top scoring peptide matches to query 4184
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates identity
Score    Expect      ppm   Hit  Protein    Peptide
 15.1     0.059      5.82    2   FHP_YEAST R.ALQIKPEHYPIVGEYLLK.A
Top scoring peptide matches to query 4191
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
  4.2       4.7      12.8    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
  4.2       4.7      12.8    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
  4.2       4.7      12.8    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
Top scoring peptide matches to query 4192
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 71.7  8.7e-007      13.2    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
 59.9  1.3e-005      13.2    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
 51.7  8.9e-005      13.2    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
 40.1    0.0013      13.2    6   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
Top scoring peptide matches to query 4194
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 29.7     0.015      4.89    1   IGF1_BOVIN K.LEYNYNSHNVYIMADKQK.N
  3.2       6.5      7.29                   K.VNPMHNDIEKNSLITETEK.A
  3.2       6.5      7.29                   K.VNPMHNDIEKNSLITETEK.A
  1.2        10      7.29                   K.VNPMHNDIEKNSLITETEK.A
Top scoring peptide matches to query 4199
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 26.3      0.03      5.51    1   IGF1_BOVIN K.LEYNYNSHNVYIMADKQK.N
Top scoring peptide matches to query 4200
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 14.9      0.43      13.6    1   IGF1_BOVIN K.LEYNYNSHNVYIMADKQK.N
 14.9      0.43      13.6    1   IGF1_BOVIN K.LEYNYNSHNVYIMADKQK.N
 14.9      0.43      13.6    1   IGF1_BOVIN K.LEYNYNSHNVYIMADKQK.N
Top scoring peptide matches to query 4206
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 29.6    0.0099      12.4    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 22.2     0.054      12.4    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 22.1     0.054      12.4    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 16.7      0.19      12.4    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
  2.0       5.7      12.4                 M.EPTHPYVKELEIACLTVQR.A
  0.7       7.5     -5.23                 K.GAPAPQAESVAEAIIRHQDPVK.V
Top scoring peptide matches to query 4207
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 24.2     0.043      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 24.2     0.043      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 24.2     0.043      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 20.5       0.1      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 20.5       0.1      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 17.4      0.21      12.0    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
Top scoring peptide matches to query 4208
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 27.9      0.02      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 27.9      0.02      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 26.1     0.031      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 18.4      0.18      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 18.4      0.18      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
 15.1      0.38      18.6    6   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
  0.8        10     -0.91                 K.LLPHACTQAAGANSRAIHAGGVK.K
Top scoring peptide matches to query 4221
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  3.1       4.6      10.7    1   IGF1_BOVIN K.GEELFTGVVPILVELDGDVNGHK.F
Top scoring peptide matches to query 4225
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 17 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  4.7       2.7      14.0    4   Q2UK92_ASPOR R.LFVFSLSPLNPGQNVPGSSHHTR.Q
Top scoring peptide matches to query 4262
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 15 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  2.8       4.7      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  2.0       5.7      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  0.2       8.6      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
Top scoring peptide matches to query 4263
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 16.4       0.2      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
 15.4      0.25      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
 13.1      0.43      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  8.7       1.2      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  5.1       2.7      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  4.9       2.8      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  3.3       4.1      13.1    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
Top scoring peptide matches to query 4436
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_3.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  1.1       1.8    -16.19   12   Q2UJR1_ASPOR K.EEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVEGVLAFKQPWPSMAR.T