MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 3 |
| MS data file | : | PRT1231_JBEI_3.mgf |
| Database | : | A-oryzae 20191108 (12,205 sequences; 5,465,702 residues) |
| Timestamp | : | 1 May 2025 at 20:39:58 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,459 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3818 |
399.1990 | 1194.5752 | 1194.5591 | 13.5 | 0 | 5 | 0.73 | 1Score > 23 indicates identity Score > 16 indicates homology |
FVVDNNMLDK + Deamidated (NQ) |
| 4238 |
904.7955 | 2711.3647 | 2711.3113 | 19.7 | 0 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
STDTPPDSPQSFTTALPPSSLMAVHK |
| 3519 |
412.7557 | 823.4968 | 823.5028 | -7.24 | 1 | 5 | 0.59 | 1Score > 15 indicates identity |
VRSLPPR |
| 3782 |
567.2698 | 1132.5250 | 1132.5223 | 2.45 | 1 | 5 | 0.93 | 1Score > 23 indicates identity Score > 17 indicates homology |
FSADYQKMK + Oxidation (M) |
| 4217 |
598.0552 | 2388.1917 | 2388.2195 | -11.6 | 1 | 5 | 0.55 | 1Score > 24 indicates identity Score > 15 indicates homology |
GPRACPGQHYAMIVLTYIVAR + Oxidation (M) |
| 3851 |
413.5436 | 1237.6090 | 1237.6302 | -17.2 | 0 | 5 | 0.44 | 1Score > 23 indicates identity Score > 14 indicates homology |
GLATASEHPLDK |
| 3499 |
804.3709 | 803.3636 | 803.3524 | 14.0 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
EYAFMK + Oxidation (M) |
| 4292 |
889.8608 | 6221.9747 | 6222.0536 | -12.7 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
TIAGVFPLVLACVGAAMMLGISSSNNNARYGGYVLAYQFPICVLSINTFMTAGISGTTK + 3 Deamidated (NQ); 2 Oxidation (M) |
| 4025 |
758.4257 | 1514.8368 | 1514.8416 | -3.16 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
QLTLSDATLRIER |
| 3894 |
651.8601 | 1301.7056 | 1301.6979 | 5.92 | 0 | 5 | 0.96 | 1Score > 23 indicates identity Score > 17 indicates homology |
LLQAFPDLQTR + Deamidated (NQ) |
| 3870 |
421.8691 | 1262.5855 | 1262.5813 | 3.33 | 0 | 5 | 0.4 | 1Score > 23 indicates identity Score > 13 indicates homology |
EGGDLVPGAMSSK + Oxidation (M) |
| 4128 |
897.9152 | 1793.8158 | 1793.8505 | -19.3 | 0 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
MNDLTSDLPYEDILR |
| 4283 |
936.9957 | 5615.9305 | 5615.8792 | 9.14 | 0 | 5 | 0.65 | 1Score > 15 indicates identity |
IPLVMYDRPQINVDIPLTVGSNLGVLVGVMTAVPWVTVMLCGIHDIDAVHK + 3 Deamidated (NQ); 3 Oxidation (M) |
| 3857 |
624.3258 | 1246.6370 | 1246.6306 | 5.16 | 0 | 5 | 1 | 1Score > 24 indicates identity Score > 17 indicates homology |
GDIFQTVPSQR |
| 3753 |
367.5351 | 1099.5835 | 1099.5873 | -3.50 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
QQLTPESAVK |
| 4158 |
484.5367 | 1934.1177 | 1934.0811 | 18.9 | 1 | 4 | 0.38 | 1Score > 13 indicates identity |
NAFRMFVSLLRPELIK + Deamidated (NQ) |
| 3482 |
394.7133 | 787.4120 | 787.4076 | 5.70 | 0 | 4 | 0.86 | 1Score > 25 indicates identity Score > 16 indicates homology |
GGNELLGK + Deamidated (NQ) |
| 3867 |
631.3521 | 1260.6896 | 1260.6727 | 13.4 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LRNAWFNIAR + Deamidated (NQ) |
| 3494 |
401.2287 | 800.4428 | 800.4504 | -9.48 | 1 | 4 | 0.49 | 1Score > 25 indicates identity Score > 14 indicates homology |
GIGNVGRK + Deamidated (NQ) |
| 3942 |
456.2542 | 1365.7408 | 1365.7365 | 3.16 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
HLQSVIDAQISR |
| 3505 |
405.2256 | 808.4366 | 808.4330 | 4.46 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VYALSEK |
| 3961 |
695.8842 | 1389.7538 | 1389.7728 | -13.7 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
GNASVYGNVIKLR |
| 4098 |
554.5991 | 1660.7755 | 1660.8056 | -18.2 | 1 | 4 | 0.47 | 1Score > 23 indicates identity Score > 13 indicates homology |
EDSFDLTPLSPRER |
| 3866 |
629.8019 | 1257.5892 | 1257.6102 | -16.6 | 1 | 4 | 0.45 | 1Score > 21 indicates identity Score > 13 indicates homology |
QAKNETWQPR + Deamidated (NQ) |
| 4236 |
889.1205 | 2664.3397 | 2664.3833 | -16.4 | 1 | 4 | 0.65 | 1Score > 23 indicates identity Score > 15 indicates homology |
DFKVQDIQLATISQMPYLDAVIR + Deamidated (NQ) |
| 3737 |
544.2939 | 1086.5732 | 1086.5557 | 16.2 | 0 | 4 | 1 | 1Score > 24 indicates identity Score > 17 indicates homology |
EVQAIQEAAK + Deamidated (NQ) |
| 3884 |
641.8154 | 1281.6162 | 1281.6243 | -6.29 | 1 | 4 | 1 | 1Score > 24 indicates identity Score > 17 indicates homology |
IAMSMGMLGIRA + 2 Oxidation (M) |
| 3710 |
525.2692 | 1048.5238 | 1048.5375 | -13.1 | 0 | 4 | 0.62 | 1Score > 24 indicates identity Score > 14 indicates homology |
ASLDIFPMR |
| 3813 |
594.3275 | 1186.6404 | 1186.6393 | 0.96 | 1 | 4 | 0.98 | 1Score > 24 indicates identity Score > 16 indicates homology |
CLLAYHRVR |
| 4132 |
603.0002 | 1805.9788 | 1805.9999 | -11.7 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
ILIDHADNKTLGQQLK |
| 3945 |
685.8496 | 1369.6846 | 1369.7024 | -12.9 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
VGVPTPMNKGANGK + Deamidated (NQ) |
| 3771 |
560.8246 | 1119.6346 | 1119.6136 | 18.8 | 1 | 4 | 0.56 | 1Score > 20 indicates identity Score > 14 indicates homology |
IKTSDGSVSVK |
| 4134 |
905.9749 | 1809.9352 | 1809.9005 | 19.2 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
LDSITYCILTMLHSK + Oxidation (M) |
| 3483 |
394.7187 | 787.4228 | 787.4188 | 5.17 | 0 | 4 | 0.81 | 1Score > 26 indicates identity Score > 15 indicates homology |
LSAAAEAR |
| 3608 |
308.8326 | 923.4760 | 923.4865 | -11.4 | 1 | 4 | 0.51 | 1Score > 22 indicates identity Score > 13 indicates homology |
KFYQPNK |
| 3720 |
533.2860 | 1064.5574 | 1064.5403 | 16.1 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
FRFNADPAK |
| 4120 |
437.4420 | 1745.7389 | 1745.7275 | 6.55 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
SGQAGSRNGGYESATMR + 2 Deamidated (NQ); Oxidation (M) |
| 4215 |
597.5755 | 2386.2729 | 2386.2467 | 11.0 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
WPLQSPPMERALHAVSEVVPK + Oxidation (M) |
| 3892 |
649.7909 | 1297.5672 | 1297.5431 | 18.6 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
EIMDMGNGEFR |
| 3466 |
380.2365 | 758.4584 | 758.4538 | 6.17 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
IKELEK |
| 3377 |
323.1919 | 644.3692 | 644.3606 | 13.5 | 0 | 4 | 0.84 | 1Score > 24 indicates identity Score > 15 indicates homology |
NAVVSR |
| 4163 |
653.3120 | 1956.9142 | 1956.9139 | 0.16 | 1 | 4 | 0.49 | 1Score > 23 indicates identity Score > 13 indicates homology |
EIIDFFQMEDEKLQR + Deamidated (NQ); Oxidation (M) |
| 3536 |
423.2294 | 844.4442 | 844.4402 | 4.74 | 0 | 4 | 1 | 1Score > 25 indicates identity Score > 16 indicates homology |
IAAEASAGR |
| 4111 |
425.6881 | 1698.7233 | 1698.7485 | -14.8 | 0 | 4 | 2.2 | 1Score > 19 indicates identity |
HSAESSELFEYTSGR |
| 3836 |
609.3251 | 1216.6356 | 1216.6299 | 4.74 | 1 | 4 | 0.85 | 1Score > 25 indicates identity Score > 15 indicates homology |
ELNDELLSKR + Deamidated (NQ) |
| 3989 |
725.8305 | 1449.6464 | 1449.6623 | -11.0 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AGFDEEVADIEQK |
| 4266 |
753.0303 | 4512.1381 | 4512.0833 | 12.1 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
RCLWNGMMLQGVPNAFFALGYLTNASWTMGVDVTALSACR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 3979 |
715.8350 | 1429.6554 | 1429.6806 | -17.6 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
QPNGRMPAAASAMK + Deamidated (NQ) |
| 3644 |
483.2461 | 964.4776 | 964.4713 | 6.60 | 0 | 3 | 0.69 | 1Score > 23 indicates identity Score > 14 indicates homology |
SSLSDELSK |
| 3776 |
563.3274 | 1124.6402 | 1124.6553 | -13.4 | 0 | 3 | 2 | 1Score > 19 indicates identity |
LLLDIAQSPR |
| 4140 |
463.7591 | 1851.0073 | 1850.9989 | 4.51 | 0 | 3 | 0.49 | 1Score > 20 indicates identity Score > 13 indicates homology |
NATLITIGDPNTPPVTVK + Deamidated (NQ) |
| 3573 |
446.7163 | 891.4180 | 891.4086 | 10.6 | 0 | 3 | 0.55 | 1Score > 23 indicates identity Score > 13 indicates homology |
QTSQHYK + Deamidated (NQ) |
| 4035 |
512.9297 | 1535.7673 | 1535.7654 | 1.24 | 1 | 3 | 0.95 | 1Score > 24 indicates identity Score > 16 indicates homology |
SEMWEVTNKAVVK + Oxidation (M) |
| 3810 |
394.2094 | 1179.6064 | 1179.5884 | 15.2 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
SSGDRNGLFVK + Deamidated (NQ) |
| 4209 |
773.7125 | 2318.1157 | 2318.1252 | -4.13 | 1 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
IPFMRLSTQEIDLQYQYR + 2 Deamidated (NQ); Oxidation (M) |
| 4401 |
1114.8191 | 7796.6828 | 7796.6095 | 9.40 | 1 | 3 | 1.2 | 1Score > 17 indicates identity |
MKPEPGVSEAGDQPVLAYPPHAPLGQVPNMHPDMRYQPQTHPNPALPLLQNPYMPGGYTSAPPMPNGGAPQGR + 7 Deamidated (NQ); 2 Oxidation (M) |
| 3941 |
683.8569 | 1365.6992 | 1365.7074 | -6.00 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
SRYIMTTELPR |
| 3356 |
312.1805 | 622.3464 | 622.3439 | 4.16 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
VSVYR |
| 3783 |
567.2706 | 1132.5266 | 1132.5223 | 3.86 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
FSADYQKMK + Oxidation (M) |
| 4097 |
831.3946 | 1660.7746 | 1660.7879 | -7.97 | 0 | 3 | 0.83 | 1Score > 23 indicates identity Score > 15 indicates homology |
NMEGAHLVTIEEFR + Oxidation (M) |
| 3690 |
515.7744 | 1029.5342 | 1029.5454 | -10.9 | 1 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
QKQQLLNR + 3 Deamidated (NQ) |
| 3987 |
483.6023 | 1447.7851 | 1447.8035 | -12.7 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
GGLLSLIYNQTLR + Deamidated (NQ) |
| 3965 |
470.9056 | 1409.6950 | 1409.6722 | 16.2 | 1 | 3 | 1 | 1Score > 24 indicates identity Score > 16 indicates homology |
GQATGRMAVDFNK + Oxidation (M) |
| 3990 |
729.3484 | 1456.6822 | 1456.7059 | -16.2 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
QYAGNGEQHIALR + Deamidated (NQ) |
| 3949 |
457.8788 | 1370.6146 | 1370.6361 | -15.7 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
QRQMQQPDAPR + Deamidated (NQ); Oxidation (M) |
| 4269 |
949.4827 | 4742.3771 | 4742.3539 | 4.90 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
FLLEAMGEVLGDALTPEILDAWATAYWQLADLMIGREAELYK + Deamidated (NQ); Oxidation (M) |
| 3672 |
337.8364 | 1010.4874 | 1010.4929 | -5.46 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
QIPYTMMK |
| 3582 |
450.7697 | 899.5248 | 899.5301 | -5.85 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
RSGVVGAVR |
| 3609 |
463.2184 | 924.4222 | 924.4188 | 3.69 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
DEQYKNK + Deamidated (NQ) |
| 3828 |
401.8651 | 1202.5735 | 1202.5713 | 1.78 | 1 | 3 | 0.95 | 1Score > 24 indicates identity Score > 15 indicates homology |
AGEEMPLRER + Oxidation (M) |
| 3840 |
610.8330 | 1219.6514 | 1219.6601 | -7.08 | 1 | 3 | 0.85 | 1Score > 23 indicates identity Score > 15 indicates homology |
EWLFIQEKK |
| 3382 |
325.1887 | 648.3628 | 648.3595 | 5.15 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
IVFDR |
| 4133 |
603.6423 | 1807.9051 | 1807.9389 | -18.7 | 1 | 3 | 0.77 | 1Score > 24 indicates identity Score > 14 indicates homology |
VMYGAEKIELSELAQK |
| 4125 |
589.6588 | 1765.9546 | 1765.9727 | -10.2 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
DFVGQHVKAADKPIIK + Deamidated (NQ) |
| 3881 |
428.1975 | 1281.5707 | 1281.5911 | -15.9 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
MTNYQIDTPAK + Deamidated (NQ) |
| 3930 |
676.3146 | 1350.6146 | 1350.6198 | -3.79 | 1 | 3 | 0.63 | 1Score > 23 indicates identity Score > 13 indicates homology |
MENVSDKQTQR + Oxidation (M) |
| 3580 |
449.7921 | 897.5696 | 897.5760 | -7.03 | 1 | 3 | 1 | 1Score > 15 indicates identity |
IIIIDRR |
| 4034 |
768.8909 | 1535.7672 | 1535.7654 | 1.23 | 1 | 3 | 0.9 | 1Score > 24 indicates identity Score > 15 indicates homology |
SEMWEVTNKAVVK + Oxidation (M) |
| 3528 |
417.7202 | 833.4258 | 833.4104 | 18.6 | 1 | 3 | 0.93 | 1Score > 24 indicates identity Score > 15 indicates homology |
SSQNRSR |
| 4123 |
883.8994 | 1765.7842 | 1765.7642 | 11.4 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
DAAYGAPSELTEEEER |
| 3951 |
458.2353 | 1371.6841 | 1371.7068 | -16.5 | 1 | 3 | 0.69 | 1Score > 23 indicates identity Score > 14 indicates homology |
SQLCTKAQLPPK + 2 Deamidated (NQ) |
| 4102 |
556.6525 | 1666.9357 | 1666.9559 | -12.1 | 1 | 3 | 2.1 | 1Score > 18 indicates identity |
VAILFFRSTTIPFR |
| 4108 |
842.9044 | 1683.7942 | 1683.7636 | 18.2 | 0 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
MFTNAVMFNPLPQR + 3 Deamidated (NQ); Oxidation (M) |
| 3995 |
732.8751 | 1463.7356 | 1463.7290 | 4.56 | 1 | 3 | 0.65 | 1Score > 24 indicates identity Score > 13 indicates homology |
DAMEGKNTLTGLAK + Oxidation (M) |
| 3695 |
519.7671 | 1037.5196 | 1037.5029 | 16.1 | 0 | 2 | 0.74 | 1Score > 23 indicates identity Score > 14 indicates homology |
LSASSGYPEK |
| 3439 |
360.6907 | 719.3668 | 719.3562 | 14.8 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
EGSSGKR |
| 4203 |
753.0729 | 2256.1969 | 2256.1613 | 15.8 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
LYGQCSAALAAVLYVPFLSGR + Deamidated (NQ) |
| 3773 |
561.7648 | 1121.5150 | 1121.5241 | -8.04 | 0 | 2 | 0.8 | 1Score > 23 indicates identity Score > 14 indicates homology |
EVQDFDELK |
| 3947 |
685.8966 | 1369.7786 | 1369.7565 | 16.2 | 1 | 2 | 0.88 | 1Score > 20 indicates identity Score > 14 indicates homology |
ALQEQVQQGKIK + Deamidated (NQ) |
| 3653 |
488.7777 | 975.5408 | 975.5349 | 6.10 | 1 | 2 | 0.92 | 1Score > 22 indicates identity Score > 14 indicates homology |
ISSVAKDTR |
| 4129 |
599.3322 | 1794.9748 | 1794.9450 | 16.6 | 1 | 2 | 2.8 | 1Score > 19 indicates identity |
MFPKEALHEQPIALR + Oxidation (M) |
| 3664 |
497.8269 | 993.6392 | 993.6223 | 17.1 | 0 | 2 | 0.59 | 1Score > 13 indicates identity |
LIAVVPASPK |
| 4363 |
1098.3813 | 7681.6182 | 7681.6523 | -4.44 | 1 | 2 | 1.3 | 1Score > 16 indicates identity |
SPAIAPQAAQSQTNEPATPAMLMRIQRPQHSPAAIGQASGPVSSESQDDIMEDVILPEAATPTTHFSQSQVAR + 4 Deamidated (NQ); 2 Oxidation (M) |
| 4099 |
554.9332 | 1661.7778 | 1661.7533 | 14.7 | 0 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NPALDVPQSSQSFNR + 3 Deamidated (NQ) |
| 3890 |
430.8529 | 1289.5369 | 1289.5484 | -8.90 | 0 | 2 | 1.4 | 1Score > 16 indicates identity |
SQQQQQQQQR + 4 Deamidated (NQ) |
| 3527 |
416.7446 | 831.4746 | 831.4701 | 5.42 | 1 | 2 | 0.8 | 1Score > 23 indicates identity Score > 14 indicates homology |
KLISENK + Deamidated (NQ) |
| 3959 |
693.8994 | 1385.7842 | 1385.7878 | -2.57 | 1 | 2 | 0.8 | 1Score > 20 indicates identity Score > 14 indicates homology |
LQQVVKVSESLR + Deamidated (NQ) |
| 4242 |
923.4483 | 2767.3231 | 2767.3164 | 2.43 | 0 | 2 | 0.73 | 1Score > 24 indicates identity Score > 13 indicates homology |
VDSGDGTWSPISPATFKPVFSPMNSK + Oxidation (M) |
| 3353 |
309.6671 | 617.3196 | 617.3133 | 10.3 | 0 | 2 | 0.91 | 1Score > 27 indicates identity Score > 14 indicates homology |
NLSQR + Deamidated (NQ) |
| 4157 |
483.2523 | 1928.9801 | 1929.0094 | -15.2 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NGKNVQNIIDLIISAWK + 4 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/