MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 3 |
| MS data file | : | PRT1231_JBEI_3.mgf |
| Database | : | A-oryzae 20191108 (12,205 sequences; 5,465,702 residues) |
| Timestamp | : | 1 May 2025 at 20:39:58 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,459 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3723 |
534.7855 | 1067.5564 | 1067.5499 | 6.15 | 0 | 9 | 0.8 | 1Score > 22 indicates identity Score > 21 indicates homology |
SGTYVITAEK |
| 3454 |
372.2347 | 742.4548 | 742.4589 | -5.41 | 0 | 9 | 0.89 | 1Score > 21 indicates identity |
QEIIIK |
| 3674 |
338.1815 | 1011.5227 | 1011.5237 | -0.97 | 0 | 9 | 0.41 | 1Score > 21 indicates identity Score > 18 indicates homology |
QPVESNLPK + Deamidated (NQ) |
| 3661 |
494.7593 | 987.5040 | 987.5236 | -19.8 | 1 | 9 | 1 | 1Score > 25 indicates identity Score > 22 indicates homology |
LANKGIDEK + Deamidated (NQ) |
| 3963 |
468.9035 | 1403.6887 | 1403.7157 | -19.3 | 0 | 9 | 0.19 | 1Score > 24 indicates identity Score > 15 indicates homology |
RPYIEQTEVNR |
| 3786 |
381.8473 | 1142.5201 | 1142.5316 | -10.1 | 0 | 9 | 0.59 | 1Score > 19 indicates identity |
RPEDEAGVNR + Deamidated (NQ) |
| 3800 |
579.8330 | 1157.6514 | 1157.6404 | 9.55 | 1 | 9 | 0.27 | 1Score > 23 indicates identity Score > 16 indicates homology |
IAAKQQQATAK + Deamidated (NQ) |
| 3501 |
402.6891 | 803.3636 | 803.3524 | 14.1 | 0 | 9 | 0.75 | 1Score > 22 indicates identity Score > 20 indicates homology |
EYAFMK + Oxidation (M) |
| 3964 |
705.3406 | 1408.6666 | 1408.6657 | 0.70 | 1 | 9 | 0.32 | 1Score > 24 indicates identity Score > 17 indicates homology |
ITGGNDKQGFPMK + Deamidated (NQ); Oxidation (M) |
| 3320 |
531.3280 | 530.3207 | 530.3176 | 5.81 | 0 | 9 | 1 | 1Score > 29 indicates identity Score > 21 indicates homology |
AVVSR |
| 3510 |
409.2266 | 816.4386 | 816.4454 | -8.22 | 0 | 9 | 0.25 | 1Score > 25 indicates identity Score > 15 indicates homology |
LGSQSGIR |
| 3904 |
658.8184 | 1315.6222 | 1315.6255 | -2.50 | 0 | 9 | 0.18 | 1Score > 23 indicates identity Score > 14 indicates homology |
VNIELAQDQER + 2 Deamidated (NQ) |
| 4014 |
500.5895 | 1498.7467 | 1498.7515 | -3.21 | 0 | 9 | 0.21 | 1Score > 23 indicates identity Score > 14 indicates homology |
EVLQEESNVQPVK + Deamidated (NQ) |
| 3649 |
487.7775 | 973.5404 | 973.5280 | 12.8 | 1 | 9 | 0.17 | 1Score > 22 indicates identity Score > 13 indicates homology |
VFLRHMR + Oxidation (M) |
| 3400 |
330.7010 | 659.3874 | 659.3966 | -13.9 | 0 | 8 | 0.57 | 1Score > 22 indicates identity Score > 19 indicates homology |
ITALSR |
| 3419 |
347.6909 | 693.3672 | 693.3810 | -19.8 | 0 | 8 | 0.2 | 1Score > 23 indicates identity Score > 14 indicates homology |
IASTFR |
| 3663 |
496.7776 | 991.5406 | 991.5484 | -7.87 | 1 | 8 | 0.22 | 1Score > 22 indicates identity Score > 14 indicates homology |
LSSGRMVVK + Oxidation (M) |
| 3699 |
522.7964 | 1043.5782 | 1043.5723 | 5.67 | 1 | 8 | 1 | 1Score > 24 indicates identity Score > 21 indicates homology |
KSAPSASQLR |
| 3790 |
575.2888 | 1148.5630 | 1148.5608 | 1.98 | 1 | 8 | 1 | 1Score > 24 indicates identity Score > 21 indicates homology |
ANRAGMSLGQK + Deamidated (NQ); Oxidation (M) |
| 3347 |
306.6967 | 611.3788 | 611.3867 | -12.8 | 1 | 8 | 0.45 | 1Score > 17 indicates identity |
ARLPR |
| 3915 |
662.7959 | 1323.5772 | 1323.5877 | -7.91 | 1 | 8 | 0.9 | 1Score > 20 indicates identity |
VRMYDAPQNGR + 2 Deamidated (NQ); Oxidation (M) |
| 3716 |
352.8703 | 1055.5891 | 1055.5764 | 12.0 | 0 | 8 | 0.18 | 1Score > 22 indicates identity Score > 13 indicates homology |
VVPQFPNVR + Deamidated (NQ) |
| 3678 |
508.8064 | 1015.5982 | 1015.5848 | 13.2 | 1 | 8 | 0.86 | 1Score > 20 indicates identity |
RALTPTMVK |
| 3376 |
322.7040 | 643.3934 | 643.3905 | 4.63 | 0 | 8 | 0.21 | 1Score > 25 indicates identity Score > 14 indicates homology |
LGDVLK |
| 3639 |
479.7726 | 957.5306 | 957.5356 | -5.12 | 1 | 8 | 0.24 | 1Score > 24 indicates identity Score > 14 indicates homology |
VAQQSLRR + Deamidated (NQ) |
| 3530 |
419.2343 | 836.4540 | 836.4392 | 17.8 | 0 | 8 | 1 | 1Score > 21 indicates identity Score > 20 indicates homology |
AVLSEYR |
| 3935 |
341.9440 | 1363.7469 | 1363.7401 | 5.00 | 1 | 8 | 0.24 | 1Score > 21 indicates identity Score > 14 indicates homology |
QFLFRFEHIK |
| 4337 |
1092.3815 | 7639.6196 | 7639.5675 | 6.81 | 0 | 8 | 0.35 | 1Score > 16 indicates identity |
ETINSFGVNSIPTSHYVPANWGFTLPTAESLDTIYANLNDGTSLSQENSLSPESLQLTPDMQQQPGELLR + 7 Deamidated (NQ) |
| 4024 |
505.9416 | 1514.8030 | 1514.7940 | 5.91 | 0 | 8 | 1 | 1Score > 22 indicates identity Score > 20 indicates homology |
VGSELLQESAQVVR + Deamidated (NQ) |
| 3575 |
446.7630 | 891.5114 | 891.5066 | 5.48 | 0 | 8 | 0.83 | 1Score > 19 indicates identity |
LVSQGLFK + Deamidated (NQ) |
| 3655 |
489.2772 | 976.5398 | 976.5454 | -5.68 | 1 | 8 | 1 | 1Score > 22 indicates identity Score > 20 indicates homology |
FASIEVRR |
| 3491 |
399.7783 | 797.5420 | 797.5487 | -8.33 | 1 | 8 | 0.17 | 1Score > 13 indicates identity |
LVGLIRK |
| 3611 |
310.5120 | 928.5142 | 928.4978 | 17.6 | 0 | 8 | 0.93 | 1Score > 24 indicates identity Score > 20 indicates homology |
IASVPTGER |
| 3887 |
643.8510 | 1285.6874 | 1285.6779 | 7.44 | 0 | 8 | 1 | 1Score > 24 indicates identity Score > 20 indicates homology |
LVQSYHAVVDR |
| 3496 |
401.7212 | 801.4278 | 801.4344 | -8.22 | 1 | 7 | 0.44 | 1Score > 25 indicates identity Score > 16 indicates homology |
LAQAKDR + Deamidated (NQ) |
| 3891 |
431.9154 | 1292.7244 | 1292.7387 | -11.1 | 1 | 7 | 0.8 | 1Score > 19 indicates identity |
MALRLPPQVPR + Oxidation (M) |
| 4214 |
597.5755 | 2386.2729 | 2386.2467 | 11.0 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
WPLQSPPMERALHAVSEVVPK + Oxidation (M) |
| 3693 |
519.2607 | 1036.5068 | 1036.5189 | -11.6 | 0 | 7 | 0.21 | 1Score > 23 indicates identity Score > 13 indicates homology |
VFSSIDVNR + Deamidated (NQ) |
| 3648 |
487.2740 | 972.5334 | 972.5141 | 19.9 | 1 | 7 | 0.89 | 1Score > 24 indicates identity Score > 19 indicates homology |
GAWLNEKR |
| 3820 |
599.8152 | 1197.6158 | 1197.5990 | 14.1 | 0 | 7 | 0.61 | 1Score > 22 indicates identity Score > 18 indicates homology |
SSPISSSSPPPR |
| 3691 |
344.8681 | 1031.5825 | 1031.5723 | 9.83 | 1 | 7 | 1 | 1Score > 21 indicates identity Score > 20 indicates homology |
LERSLASTR |
| 3423 |
350.7232 | 699.4318 | 699.4279 | 5.62 | 0 | 7 | 1 | 1Score > 21 indicates identity Score > 20 indicates homology |
QNVLVK |
| 3764 |
558.7803 | 1115.5460 | 1115.5645 | -16.5 | 1 | 7 | 0.27 | 1Score > 23 indicates identity Score > 14 indicates homology |
MVQQPKQEK + Deamidated (NQ) |
| 3427 |
703.4026 | 702.3953 | 702.3912 | 5.89 | 0 | 7 | 0.3 | 1Score > 26 indicates identity Score > 15 indicates homology |
SLADAVK |
| 3823 |
600.8362 | 1199.6578 | 1199.6510 | 5.71 | 1 | 7 | 0.55 | 1Score > 22 indicates identity Score > 17 indicates homology |
SKTPPLTVDSR |
| 3487 |
395.2366 | 788.4586 | 788.4657 | -8.94 | 0 | 7 | 0.37 | 1Score > 21 indicates identity Score > 15 indicates homology |
LFTRPR |
| 3597 |
458.2693 | 914.5240 | 914.5185 | 6.07 | 1 | 7 | 0.5 | 1Score > 23 indicates identity Score > 17 indicates homology |
KAGLEELR |
| 4178 |
670.6866 | 2009.0380 | 2009.0694 | -15.6 | 1 | 7 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
DIISNISNTPPVRFHTAK |
| 3436 |
358.7205 | 715.4264 | 715.4228 | 5.07 | 0 | 7 | 0.9 | 1Score > 22 indicates identity Score > 19 indicates homology |
QSVLLR + Deamidated (NQ) |
| 3468 |
381.2135 | 760.4124 | 760.4079 | 6.00 | 1 | 7 | 0.79 | 1Score > 25 indicates identity Score > 19 indicates homology |
QRQLSK + 2 Deamidated (NQ) |
| 3880 |
640.8309 | 1279.6472 | 1279.6673 | -15.7 | 1 | 7 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
SNRVFYPLQR + Deamidated (NQ) |
| 3946 |
685.8810 | 1369.7474 | 1369.7201 | 19.9 | 0 | 7 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
SLTPSGSGGQLPIR + Deamidated (NQ) |
| 3715 |
527.8318 | 1053.6490 | 1053.6447 | 4.11 | 1 | 7 | 0.42 | 1Score > 16 indicates identity |
RQFLLHIK |
| 3707 |
523.8063 | 1045.5980 | 1045.5808 | 16.5 | 0 | 7 | 0.76 | 1Score > 20 indicates identity Score > 18 indicates homology |
FLPGLLSGDK |
| 3551 |
869.4181 | 868.4108 | 868.4113 | -0.53 | 1 | 7 | 1 | 1Score > 21 indicates identity Score > 19 indicates homology |
KSTLNCF |
| 3736 |
363.1982 | 1086.5728 | 1086.5557 | 15.7 | 0 | 7 | 0.82 | 1Score > 24 indicates identity Score > 18 indicates homology |
EVQAIQEAAK + Deamidated (NQ) |
| 3803 |
581.3255 | 1160.6364 | 1160.6190 | 15.1 | 0 | 7 | 0.87 | 1Score > 23 indicates identity Score > 19 indicates homology |
GSPEALIVGYR |
| 3877 |
639.3498 | 1276.6850 | 1276.6663 | 14.7 | 0 | 7 | 0.46 | 1Score > 22 indicates identity Score > 16 indicates homology |
FAVADGDIQTIK |
| 3437 |
360.2280 | 718.4414 | 718.4377 | 5.16 | 0 | 7 | 0.43 | 1Score > 16 indicates identity |
LAGAIFK |
| 3615 |
465.7580 | 929.5014 | 929.5182 | -18.0 | 0 | 7 | 0.32 | 1Score > 24 indicates identity Score > 14 indicates homology |
QQIVSDLK |
| 3572 |
445.7614 | 889.5082 | 889.5021 | 6.87 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
GIPITYAR |
| 3754 |
550.8041 | 1099.5936 | 1099.5986 | -4.46 | 1 | 7 | 0.65 | 1Score > 23 indicates identity Score > 17 indicates homology |
AITRNVDSPK |
| 3812 |
593.8225 | 1185.6304 | 1185.6465 | -13.6 | 1 | 7 | 0.35 | 1Score > 24 indicates identity Score > 14 indicates homology |
NALALSVADRR + Deamidated (NQ) |
| 3328 |
566.2639 | 565.2566 | 565.2530 | 6.43 | 0 | 7 | 1 | 1Score > 19 indicates identity |
NTMGK + Oxidation (M) |
| 3905 |
658.8535 | 1315.6924 | 1315.6884 | 3.04 | 1 | 7 | 0.36 | 1Score > 24 indicates identity Score > 15 indicates homology |
KQYHTNTPTVK |
| 4293 |
892.4324 | 6239.9759 | 6239.9224 | 8.57 | 1 | 6 | 0.95 | 1Score > 19 indicates identity |
AQAAQKAQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 5 Deamidated (NQ); 4 Oxidation (M) |
| 3974 |
714.3710 | 1426.7274 | 1426.7092 | 12.8 | 0 | 6 | 0.36 | 1Score > 23 indicates identity Score > 15 indicates homology |
IGPESPNFVDVPR + Deamidated (NQ) |
| 3507 |
407.7454 | 813.4762 | 813.4708 | 6.65 | 0 | 6 | 0.49 | 1Score > 22 indicates identity Score > 16 indicates homology |
IGDLGLAR |
| 4456 |
983.0919 | 7856.6770 | 7856.5727 | 13.3 | 0 | 6 | 0.41 | 1Score > 15 indicates identity |
TVMYGFSGGAYATEWASELHSTYAPDLTQIVGAAMGGPPPNVTDTYLGCNMGPWAELNVWAMLGVMNAVPEMK + 4 Oxidation (M) |
| 3592 |
304.8362 | 911.4868 | 911.4865 | 0.32 | 1 | 6 | 0.37 | 1Score > 20 indicates identity Score > 14 indicates homology |
LGKYFQR + Deamidated (NQ) |
| 3976 |
476.5836 | 1426.7290 | 1426.7304 | -0.97 | 0 | 6 | 0.76 | 1Score > 23 indicates identity Score > 18 indicates homology |
EGLDITLSDIHSK |
| 3396 |
330.1971 | 658.3796 | 658.3762 | 5.23 | 1 | 6 | 0.85 | 1Score > 24 indicates identity Score > 18 indicates homology |
LRADGK |
| 3854 |
621.8773 | 1241.7400 | 1241.7244 | 12.6 | 1 | 6 | 0.6 | 1Score > 16 indicates identity |
WVLRSDLVVR |
| 3543 |
429.7398 | 857.4650 | 857.4607 | 5.10 | 0 | 6 | 0.76 | 1Score > 24 indicates identity Score > 18 indicates homology |
ALGTPSGQK |
| 3585 |
451.2559 | 900.4972 | 900.4916 | 6.26 | 1 | 6 | 1 | 1Score > 24 indicates identity Score > 19 indicates homology |
KSPEEIAK |
| 3758 |
372.1962 | 1113.5668 | 1113.5819 | -13.6 | 0 | 6 | 0.71 | 1Score > 23 indicates identity Score > 17 indicates homology |
QGDPLWTIGK |
| 3705 |
523.2929 | 1044.5712 | 1044.5637 | 7.21 | 1 | 6 | 0.73 | 1Score > 23 indicates identity Score > 17 indicates homology |
MAPLKLNNK + Deamidated (NQ); Oxidation (M) |
| 3399 |
330.6826 | 659.3506 | 659.3490 | 2.55 | 0 | 6 | 0.98 | 1Score > 27 indicates identity Score > 19 indicates homology |
AEEAIK |
| 3539 |
425.7269 | 849.4392 | 849.4378 | 1.68 | 0 | 6 | 0.31 | 1Score > 23 indicates identity Score > 13 indicates homology |
LLNTMSR + Oxidation (M) |
| 3593 |
457.2268 | 912.4390 | 912.4527 | -15.0 | 0 | 6 | 0.28 | 1Score > 20 indicates identity Score > 13 indicates homology |
FFEMIAR |
| 4265 |
903.2357 | 4511.1421 | 4511.1717 | -6.55 | 1 | 6 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
DRNHVGVYIGTPSVDYEHNVATHPLNAFMATGNLQSYLPGR + Deamidated (NQ) |
| 3373 |
321.7384 | 641.4622 | 641.4588 | 5.37 | 1 | 6 | 0.38 | 1Score > 14 indicates identity |
KLLLR |
| 4164 |
654.0120 | 1959.0142 | 1958.9949 | 9.84 | 1 | 6 | 0.29 | 1Score > 23 indicates identity Score > 13 indicates homology |
IVLDTDDPAFGGLNRNLK + 2 Deamidated (NQ) |
| 3669 |
501.7979 | 1001.5812 | 1001.5692 | 12.0 | 1 | 6 | 0.98 | 1Score > 21 indicates identity Score > 18 indicates homology |
VCRDIVIK |
| 3689 |
515.2566 | 1028.4986 | 1028.5026 | -3.81 | 0 | 6 | 0.57 | 1Score > 22 indicates identity Score > 16 indicates homology |
NAQVELPQK + 3 Deamidated (NQ) |
| 4078 |
322.5529 | 1607.7281 | 1607.7349 | -4.19 | 1 | 6 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
GVLGEDLNGMGVKSSE + Deamidated (NQ); Oxidation (M) |
| 3756 |
553.7983 | 1105.5820 | 1105.6019 | -18.0 | 0 | 6 | 0.6 | 1Score > 23 indicates identity Score > 16 indicates homology |
QVIQLTFEK + Deamidated (NQ) |
| 3936 |
341.9441 | 1363.7473 | 1363.7235 | 17.5 | 0 | 6 | 0.4 | 1Score > 21 indicates identity Score > 14 indicates homology |
VSIGVEYLEDLK |
| 4364 |
961.3334 | 7682.6090 | 7682.7330 | -16.1 | 1 | 6 | 0.59 | 1Score > 16 indicates identity |
SMPQPSTPQSLPSHQYHSSANQPLSTQQRPSPLSAPMTSHGLTSGILTMPISMSLHLGANSHFLLGRLNFK + 4 Deamidated (NQ); 3 Oxidation (M) |
| 4053 |
784.9166 | 1567.8186 | 1567.8392 | -13.1 | 1 | 6 | 0.32 | 1Score > 23 indicates identity Score > 13 indicates homology |
SRLQTAPVPMPDLK + Oxidation (M) |
| 3350 |
307.7001 | 613.3856 | 613.3799 | 9.37 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
LPASVK |
| 3798 |
579.3205 | 1156.6264 | 1156.6451 | -16.2 | 0 | 5 | 0.79 | 1Score > 23 indicates identity Score > 17 indicates homology |
ALANALESIVR + Deamidated (NQ) |
| 4106 |
839.4242 | 1676.8338 | 1676.8596 | -15.4 | 0 | 5 | 1 | 1Score > 24 indicates identity Score > 18 indicates homology |
TLMSFLTDIPQHFK |
| 4077 |
322.5527 | 1607.7271 | 1607.6965 | 19.1 | 0 | 5 | 0.76 | 1Score > 22 indicates identity Score > 17 indicates homology |
VSHHSTSDDSFAYR |
| 3473 |
387.7417 | 773.4688 | 773.4647 | 5.39 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
VQASIKK + Deamidated (NQ) |
| 4204 |
754.0941 | 2259.2605 | 2259.2986 | -16.9 | 0 | 5 | 0.83 | 1Score > 17 indicates identity |
ILLLIGLVMLTFITMVGGNPK + Deamidated (NQ); Oxidation (M) |
| 4072 |
532.2682 | 1593.7828 | 1593.7717 | 6.94 | 1 | 5 | 1 | 1Score > 24 indicates identity Score > 18 indicates homology |
DPKPFAPMMKLCK + 2 Oxidation (M) |
| 4351 |
1095.6637 | 7662.5950 | 7662.5625 | 4.24 | 0 | 5 | 0.73 | 1Score > 16 indicates identity |
SSNIVIQNSVINNGDDCVSFKPNSTEILVQNLHCNGSHGISVGSLGQYQGEVDIVQNVLVHNISMYNASR + 8 Deamidated (NQ); Oxidation (M) |
| 3879 |
640.3123 | 1278.6100 | 1278.5993 | 8.41 | 0 | 5 | 1 | 1Score > 24 indicates identity Score > 18 indicates homology |
QADFQTYLHR + Deamidated (NQ) |
| 3465 |
380.2001 | 758.3856 | 758.3922 | -8.69 | 0 | 5 | 0.38 | 1Score > 23 indicates identity Score > 13 indicates homology |
SSINNPK |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/