MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 3
MS data file : PRT1231_JBEI_3.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:39:58 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,459

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 11–20 (out of 36)

Page: Previous 1 2 3 4 Next 

+11

Accession Score Description
1 Q2ULW0_ASPOR 53 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000247 PE=4 SV=1

-12

Accession Score Description
1 Q2UJR1_ASPOR 49 Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1
Score Mass Matches Sequences emPAI
12.1 Q2UJR1_ASPOR 49 74750 8 (4) 8 (4) 0.19
Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1

-8 peptide matches (8 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
3434   358.2311 714.4476 714.4428 6.73 0 27 0.022 +1Score > 23 indicates identity U R.VAWVLK.Q
3578   448.2323 894.4500 894.4447 6.01 0 35 0.0027 +1Score > 22 indicates identity U K.LYDESIR.S
3721   533.3039 1064.5932 1064.5866 6.25 0 16 0.12 +1Score > 19 indicates identity U R.TITYGELLR.E
3766   373.2139 1116.6199 1116.6139 5.36 1 27 0.0035 +1Score > 23 indicates identity
Score > 15 indicates homology		 U K.VVITTDEGKR.G
3817   598.2831 1194.5516 1194.5451 5.45 0 18 0.18 +1Score > 23 indicates identity U R.LNAAYNCVDR.H
3848   616.3106 1230.6066 1230.5993 5.96 0 4 1 +1Score > 24 indicates identity
Score > 17 indicates homology		 U R.TGTEVPWTQGR.D
4058   788.3886 1574.7626 1574.7576 3.20 0 19 0.049 +1Score > 24 indicates identity
Score > 19 indicates homology		 U K.VAIIYEADEPNEGR.T
4436   979.3424 7826.6810 7826.8077 -16.2 1 1 1.8 +1Score > 16 indicates identity U K.EEAHICDTYWQTETGSNVITPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVEGVLAFKQPWPSMAR.T + Oxidation (M)

+13

Accession Score Description
1 Q2U0N5_ASPOR 38 GAT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000365 PE=4 SV=1

+14

Accession Score Description
1 Q2UU14_ASPOR 36 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000505 PE=3 SV=1

+15

Accession Score Description
1 Q2UPJ0_ASPOR 36 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001622 PE=4 SV=1

+16

Accession Score Description
1 Q2UR52_ASPOR 34 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000967 PE=4 SV=1

+17

Accession Score Description
1 Q2UK62_ASPOR 32 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1

+18

Accession Score Description
1 Q2UKB4_ASPOR 32 Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1

+19

Accession Score Description
1 Q2U0S3_ASPOR 32 description

+20

Accession Score Description
1 Q2U1V7_ASPOR 30 ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1
Page: Previous 1 2 3 4 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/