MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 3
MS data file : PRT1231_JBEI_3.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:39:58 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,459

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 36)


Page: 1 2 3 4 Next 

-1

Accession Score Description
1 IGF1_BOVIN 1232 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
Score Mass Matches Sequences emPAI
1.1 IGF1_BOVIN 1232 42206 77 (55) 24 (20) 16.58
Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal

-77 peptide matches (53 non-duplicate, 24 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
3333   579.3172 578.3099 578.3064 6.07 0 30 0.017 +1Score > 25 indicates identity U K.GIDFK.E
3388 +1 328.1958 654.3770 654.3741 4.51 0 35 0.00046 +1Score > 14 indicates identity U R.TIFFK.D
3389   655.3849 654.3776 654.3741 5.39 0 30 0.0014 +1Score > 14 indicates identity U R.TIFFK.D
3489 +1 395.6833 789.3520 789.3479 5.20 0 14 0.29 +1Score > 21 indicates identity U R.YPDHMK.Q
3516 +1 411.2027 820.3908 820.3868 4.94 0 30 0.0096 +1Score > 23 indicates identity
Score > 22 indicates homology
U K.QHDFFK.S
3520   826.4166 825.4093 825.4055 4.65 0 26 0.015 +1Score > 21 indicates identity U K.FICTTGK.L
3522 +1 413.7123 825.4100 825.4055 5.53 0 37 0.0013 +1Score > 21 indicates identity U K.FICTTGK.L
3600   307.1847 918.5323 918.5287 3.90 1 13 0.23 +1Score > 19 indicates identity U K.NGIKVNFK.I
3601   460.2740 918.5334 918.5287 5.18 1 14 0.19 +1Score > 19 indicates identity U K.NGIKVNFK.I
3602 +1 307.5128 919.5166 919.5127 4.22 1 26 0.0081 +1Score > 21 indicates identity
Score > 18 indicates homology
U K.NGIKVNFK.I + Deamidated (NQ)
3604 +1 460.7662 919.5178 919.5127 5.60 1 32 0.0044 +1Score > 21 indicates identity U K.NGIKVNFK.I + Deamidated (NQ)
3656   328.1715 981.4927 981.4879 4.82 0 16 0.21 +1Score > 21 indicates identity U K.EDGNILGHK.L
3657   491.7538 981.4930 981.4879 5.20 0 54 3.5e-005 +1Score > 21 indicates identity U K.EDGNILGHK.L
3712 +1 525.7671 1049.5196 1049.5142 5.21 0 62 8.5e-006 +1Score > 24 indicates identity U K.FEGDTLVNR.I
3873 +1 633.7963 1265.5780 1265.5710 5.56 0 64 3.7e-006 +1Score > 23 indicates identity U K.SAMPEGYVQER.T
3882 +1 641.7935 1281.5724 1281.5659 5.08 0 58 1.4e-005 +1Score > 22 indicates identity U K.SAMPEGYVQER.T + Oxidation (M)
3923 -1 449.8932 1346.6578 1346.6507 5.28 1 51 3.4e-005 +1Score > 24 indicates identity
Score > 19 indicates homology
U R.TIFFKDDGNYK.T
3925   449.8934 1346.6584 1346.6507 5.72 1 (38) 0.00059 +1Score > 24 indicates identity
Score > 18 indicates homology
U R.TIFFKDDGNYK.T
3924 +1 674.3363 1346.6580 1346.6507 5.48 1 65 1.3e-006 +1Score > 24 indicates identity
Score > 18 indicates homology
U R.TIFFKDDGNYK.T
3970   474.2516 1419.7330 1419.7254 5.34 0 53 1.3e-005 +1Score > 23 indicates identity
Score > 16 indicates homology
U R.LEMYCAPLKPAK.S
3971   710.8738 1419.7330 1419.7254 5.40 0 61 2.3e-006 +1Score > 23 indicates identity
Score > 17 indicates homology
U R.LEMYCAPLKPAK.S
3983   718.8711 1435.7276 1435.7203 5.11 0 34 0.0015 +1Score > 23 indicates identity
Score > 19 indicates homology
U R.LEMYCAPLKPAK.S + Oxidation (M)
3984   479.5839 1435.7299 1435.7203 6.66 0 44 0.00045 +1Score > 23 indicates identity U R.LEMYCAPLKPAK.S + Oxidation (M)
4002 +1 739.3894 1476.7642 1476.7572 4.74 1 68 2.1e-006 +1Score > 24 indicates identity
Score > 23 indicates homology
U R.AEVKFEGDTLVNR.I
4005 +2 493.2628 1476.7666 1476.7572 6.31 1 62 2.1e-006 +1Score > 23 indicates identity
Score > 18 indicates homology
U R.AEVKFEGDTLVNR.I
4017 +2 752.3374 1502.6602 1502.6525 5.14 0 111 6.2e-011 +1Score > 21 indicates identity U K.FSVSGEGEGDATYGK.L
4031   767.4211 1532.8276 1532.8198 5.09 1 39 0.00025 +1Score > 21 indicates identity
Score > 16 indicates homology
U K.FEGDTLVNRIELK.G
4032   511.9503 1532.8291 1532.8198 6.02 1 20 0.071 +1Score > 21 indicates identity U K.FEGDTLVNRIELK.G
4038   771.9023 1541.7900 1541.7838 4.05 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology
U K.GIDFKEDGNILGHK.L
4039 +2 386.4550 1541.7909 1541.7838 4.60 1 27 0.006 +1Score > 24 indicates identity
Score > 17 indicates homology
U K.GIDFKEDGNILGHK.L
4043 +2 514.9381 1541.7925 1541.7838 5.63 1 56 8.8e-006 +1Score > 24 indicates identity
Score > 18 indicates homology
U K.GIDFKEDGNILGHK.L
4047   776.8508 1551.6870 1551.6810 3.89 0 57 1.4e-005 +1Score > 21 indicates identity U R.APQTGIVDECCFR.S
4048   518.2365 1551.6877 1551.6810 4.29 0 15 0.24 +1Score > 21 indicates identity U R.APQTGIVDECCFR.S
4061 +1 394.9660 1575.8349 1575.8265 5.33 1 24 0.0088 +1Score > 23 indicates identity
Score > 16 indicates homology
U R.RLEMYCAPLKPAK.S
4062   526.2858 1575.8356 1575.8265 5.76 1 33 0.0052 +1Score > 23 indicates identity U R.RLEMYCAPLKPAK.S
4068 +1 531.6174 1591.8304 1591.8214 5.63 1 34 0.0043 +1Score > 23 indicates identity U R.RLEMYCAPLKPAK.S + Oxidation (M)
4069 +1 398.9649 1591.8305 1591.8214 5.71 1 26 0.031 +1Score > 23 indicates identity U R.RLEMYCAPLKPAK.S + Oxidation (M)
4076   402.9386 1607.7253 1607.7191 3.85 1 13 0.079 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.YPDHMKQHDFFK.S + Oxidation (M)
4081 +1 403.1901 1608.7313 1608.7031 17.5 1 13 0.62 +1Score > 23 indicates identity U R.YPDHMKQHDFFK.S + Deamidated (NQ); Oxidation (M)
4100   834.3984 1666.7822 1666.7740 4.97 0 48 5.6e-005 +1Score > 23 indicates identity
Score > 18 indicates homology
U R.GFYFNKPTGYGSSSR.R
4101   556.6022 1666.7848 1666.7740 6.48 0 33 0.0017 +1Score > 23 indicates identity
Score > 18 indicates homology
U R.GFYFNKPTGYGSSSR.R
4103   556.9346 1667.7820 1667.7580 14.4 0 26 0.0078 +1Score > 23 indicates identity
Score > 17 indicates homology
U R.GFYFNKPTGYGSSSR.R + Deamidated (NQ)
4113   854.9018 1707.7890 1707.7821 4.06 1 12 0.11 +1Score > 23 indicates identity
Score > 15 indicates homology
U R.RAPQTGIVDECCFR.S
4114   570.2712 1707.7918 1707.7821 5.65 1 39 0.0013 +1Score > 23 indicates identity
Score > 23 indicates homology
U R.RAPQTGIVDECCFR.S
4171   987.4604 1972.9062 1972.8989 3.74 0 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology
U K.LEYNYNSHNVYIMADK.Q
4172   658.6439 1972.9099 1972.8989 5.58 0 50 2.1e-005 +1Score > 22 indicates identity
Score > 16 indicates homology
U K.LEYNYNSHNVYIMADK.Q
4173   658.9731 1973.8975 1973.8829 7.40 0 24 0.032 +1Score > 22 indicates identity U K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ)
4177   664.3099 1989.9079 1989.8778 15.1 0 47 0.00021 +1Score > 23 indicates identity U K.LEYNYNSHNVYIMADK.Q + Deamidated (NQ); Oxidation (M)
4194   558.2731 2229.0633 2229.0524 4.89 1 30 0.0033 +1Score > 24 indicates identity
Score > 17 indicates homology
U K.LEYNYNSHNVYIMADKQK.N
4199   562.2722 2245.0597 2245.0473 5.51 1 26 0.03 +1Score > 24 indicates identity U K.LEYNYNSHNVYIMADKQK.N + Oxidation (M)
4200   749.6946 2246.0620 2246.0313 13.6 1 15 0.43 +1Score > 24 indicates identity U K.LEYNYNSHNVYIMADKQK.N + Deamidated (NQ); Oxidation (M)
4221   813.4285 2437.2637 2437.2377 10.7 0 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
U K.GEELFTGVVPILVELDGDVNGHK.F + Deamidated (NQ)
4262   895.6456 4473.1916 4473.1360 12.4 0 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D + 2 Deamidated (NQ)
4263   895.6462 4473.1946 4473.1360 13.1 0 16 0.2 +1Score > 22 indicates identity U R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D + 2 Deamidated (NQ)

3 subsets and intersections (4 subset proteins in total)

Score Mass Subset of
B7UCZ6_9RHAB 973 85329 1.1
G protein/GFP fusion protein OS=Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP OX=582817 GN=G PE=3 SV=1
1 sameset of B7UCZ6_9RHAB
GFP_AEQVI 973 26983
Green fluorescent protein OS=Aequorea victoria GN=GFP PE=1 SV=1
Q2U8R9_ASPOR 36 0 1.1
description
Q2UMK6_ASPOR 30 0 1.1
description

+2

Accession Score Description
1 FHP_YEAST 209 Flavohemoprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHB1 PE=1 SV=2

+3

Accession Score Description
1 Q2U2R5_ASPOR 193 WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000349 PE=4 SV=1

+4

Accession Score Description
1 Q2UK92_ASPOR 179 AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1

+5

Accession Score Description
1 Q2UHF6_ASPOR 171 Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1

+6

Accession Score Description
1 TRYP_PIG 160 Trypsin OS=Sus scrofa PE=1 SV=1

+7

Accession Score Description
1 Q2U034_ASPOR 149 SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1

+8

Accession Score Description
1 Q2U287_ASPOR 82 UTP--glucose-1-phosphate uridylyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000558 PE=3 SV=1

+9

Accession Score Description
1 Q2U480_ASPOR 69 eIF-5a domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090020000450 PE=4 SV=1

+10

Accession Score Description
1 Q2UPG4_ASPOR 63 Delta-aminolevulinic acid dehydratase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001652 PE=3 SV=1
Page: 1 2 3 4 Next 

Not what you expected? Try the select summary.