MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1231_JBEI_2.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:39:04 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4391)

Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4068 352.2051 702.3956 702.3912 6.33 0 4 0.46 +1Score > 26 indicates identity
Score > 13 indicates homology		 GIDVTAK
4237 514.8110 1027.6074 1027.6026 4.75 0 4 0.6 +1Score > 21 indicates identity
Score > 14 indicates homology		 VGIALESALR
4327 421.8795 1262.6167 1262.6367 -15.9 0 4 1 +1Score > 24 indicates identity
Score > 16 indicates homology		 FSDQGRPSITR
4157 428.7683 855.5220 855.5290 -8.13 1 4 0.87 +1Score > 20 indicates identity
Score > 16 indicates homology		 IAEIVRR
4409 709.0396 2124.0970 2124.0925 2.10 0 4 1 +1Score > 23 indicates identity
Score > 16 indicates homology		 TFTLACGVAQNGIQLILFR + 3 Deamidated (NQ)
4239 515.7736 1029.5326 1029.5243 8.09 0 3 0.51 +1Score > 24 indicates identity
Score > 13 indicates homology		 LNGYPVPNR + Deamidated (NQ)
4400 653.6453 1957.9141 1957.9091 2.54 1 3 0.72 +1Score > 23 indicates identity
Score > 14 indicates homology		 AAQCLVQSNYTQPGKYK + 3 Deamidated (NQ)
4149 422.2578 842.5010 842.4974 4.34 1 3 0.83 +1Score > 23 indicates identity
Score > 15 indicates homology		 VKGVGNLR + Deamidated (NQ)
4244 521.7643 1041.5140 1041.5203 -6.00 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology		 ADEPDALRR
4341 651.8602 1301.7058 1301.6874 14.2 1 3 0.93 +1Score > 23 indicates identity
Score > 15 indicates homology		 ICLRQNQITR + Deamidated (NQ)
4012 314.6993 627.3840 627.3816 3.84 1 3 1.5 +1Score > 17 indicates identity RVPTR
4240 516.3054 1030.5962 1030.5910 5.07 0 3 2.6 +1Score > 19 indicates identity VLDELTLTK
4302 580.8021 1159.5896 1159.5945 -4.21 1 2 0.97 +1Score > 24 indicates identity
Score > 15 indicates homology		 ADQLRVSQSR + Deamidated (NQ)
4156 428.7681 855.5216 855.5178 4.53 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 IAANLQVK
4166 435.7759 869.5372 869.5334 4.39 0 2 1.9 +1Score > 18 indicates identity VQLELLR
4024 321.7381 641.4616 641.4588 4.44 1 2 0.87 +1Score > 14 indicates identity KLLLR
4015 314.7246 627.4346 627.4319 4.31 0 2 1.4 +1Score > 16 indicates identity LVVGLK
3990 300.6725 599.3304 599.3279 4.31 0 2 0.87 +1Score > 20 indicates identity
Score > 14 indicates homology		 QGLGPK + Deamidated (NQ)
4312 609.8228 1217.6310 1217.6326 -1.25 0 2 0.91 +1Score > 24 indicates identity
Score > 14 indicates homology		 DIVLQASDVMK
4276 550.8037 1099.5928 1099.6098 -15.4 1 2 0.85 +1Score > 23 indicates identity
Score > 14 indicates homology		 RLTSNSLGPR
4049 336.1574 670.3002 670.2962 6.01 0 2 2.3 +1Score > 18 indicates identity FFNNK + 2 Deamidated (NQ)
4069 352.6962 703.3778 703.3687 13.0 0 2 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 GLLCGGK
4322 418.2361 1251.6865 1251.6935 -5.64 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LASTIGIAVDHR
4113 395.2287 788.4428 788.4578 -19.0 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 AVMAIIR + Oxidation (M)
4265 539.3040 1076.5934 1076.5760 16.2 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MVALRTSAGR + Oxidation (M)
4288 567.2689 1132.5232 1132.5223 0.86 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 FSADYQKMK + Oxidation (M)
4362 705.3410 1408.6674 1408.6834 -11.3 0 2 0.96 +1Score > 24 indicates identity
Score > 14 indicates homology		 ITSAFSVDVEGQR + Deamidated (NQ)
4429 910.1048 2727.2926 2727.3035 -4.00 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 TQQQQQQQQQAPPPMPQNVPQGPK + Deamidated (NQ); Oxidation (M)
4291 574.7869 1147.5592 1147.5768 -15.3 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 ANRAGMSLGQK + Oxidation (M)
4304 595.3188 1188.6230 1188.6060 14.3 0 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 LVELCDEALK
4301 579.8326 1157.6506 1157.6655 -12.9 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 AAEIISLNLSK
4251 523.2920 1044.5694 1044.5498 18.8 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 EMVRVAGQR
4437 925.8306 2774.4700 2774.4199 18.1 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LLSVQLEAQPQTTVAGTPNHNTQAQK + Deamidated (NQ)
4373 498.5854 1492.7344 1492.7344 0.0080 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 MNNPKAALIQYGR + 2 Deamidated (NQ); Oxidation (M)
3999 307.6988 613.3830 613.3799 5.14 0 1 0.83 +1Score > 20 indicates identity
Score > 13 indicates homology		 LPASVK
4347 660.8522 1319.6898 1319.7058 -12.1 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NGVAHALRASAPR + Deamidated (NQ)
4346 658.8521 1315.6896 1315.7096 -15.1 1 1 0.91 +1Score > 24 indicates identity
Score > 13 indicates homology		 TVKDLQSQIER
4131 405.2256 808.4366 808.4330 4.46 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VYALSEK
4446 1130.5593 3388.6561 3388.6470 2.68 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NGGHSYAGLSTTNDGILLDLSRMNDVYLQHK
4298 579.3201 1156.6256 1156.6200 4.86 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 SPAVGTLTAANR
4331 426.2370 1275.6892 1275.6935 -3.40 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AASFTRLAGSAPK
4230 338.5128 1012.5166 1012.5342 -17.4 1 1 0.86 +1Score > 22 indicates identity
Score > 13 indicates homology		 EGFLKTYR
4114 395.2288 788.4430 788.4392 4.89 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GGISKAQK + Deamidated (NQ)
4264 537.2856 1072.5566 1072.5625 -5.46 1 1 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 LGNRSDNAVK
4207 479.7716 957.5286 957.5243 4.50 0 1 0.99 +1Score > 24 indicates identity
Score > 14 indicates homology		 IQGVLNTGR + Deamidated (NQ)
4353 676.3183 1350.6220 1350.6204 1.20 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 FEIWDTAGQER
4447 992.5155 3966.0329 3966.0900 -14.4 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ILSHVYIMVFAPLLSLSLATSVAGHGYMYIPSSRTR + Oxidation (M)
4421 854.7825 2561.3257 2561.3208 1.90 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 SAKIIAMMVVGFCVLAAFVAYER + Oxidation (M)
4167 435.7760 869.5374 869.5334 4.64 0 1 2.6 +1Score > 18 indicates identity VALNILAR + Deamidated (NQ)
4365 481.9147 1442.7223 1442.7365 -9.87 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 EALSPTQSDGGLIR
4030 325.1885 648.3624 648.3595 4.53 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 IVFDR
4338 643.8509 1285.6872 1285.6740 10.3 0 1 0.92 +1Score > 24 indicates identity
Score > 13 indicates homology		 LLNWVVEGIPM + Oxidation (M)
4124 401.7260 801.4374 801.4344 3.74 0 1 0.87 +1Score > 26 indicates identity
Score > 13 indicates homology		 SADLAVAR
4397 464.0095 1852.0089 1851.9764 17.5 1 1 0.95 +1Score > 20 indicates identity
Score > 13 indicates homology		 SLLQRIFSMTLNDGIK + Deamidated (NQ); Oxidation (M)
4181 451.2556 900.4966 900.4889 8.56 1 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 GASRQINR
4203 473.7479 945.4812 945.4879 -7.05 1 1 0.87 +1Score > 24 indicates identity
Score > 13 indicates homology		 ANQNRTLK + 2 Deamidated (NQ)
4245 522.2983 1042.5820 1042.6022 -19.4 0 1 0.88 +1Score > 23 indicates identity
Score > 13 indicates homology		 GLQDLLSAVK
4267 544.2934 1086.5722 1086.5669 4.90 0 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 NVDGIGLSNAK
4374 500.5894 1498.7464 1498.7515 -3.41 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 EVLQEESNVQPVK + Deamidated (NQ)
4345 658.8183 1315.6220 1315.6442 -16.8 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LQLNIQPNMAR + 3 Deamidated (NQ); Oxidation (M)
4289 382.5398 1144.5976 1144.5798 15.5 0 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 MAEVSDGLPVK
4317 618.8779 1235.7412 1235.7238 14.1 0 0 0.95 +1Score > 13 indicates identity VVEVGVAVSHLK
4098 386.2292 770.4438 770.4399 5.15 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 LGGLQQR
4115 395.2362 788.4578 788.4545 4.31 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 IFREPK
1 300.0847 299.0774
2 300.1516 299.1443
3 300.1819 299.1746
4 300.1820 299.1747
5 301.0613 300.0540
6 301.0860 300.0787
7 301.0867 300.0794
8 301.0879 300.0806
9 301.0963 300.0890
10 301.1046 300.0973
11 301.1046 300.0973
12 301.1048 300.0975
13 301.1051 300.0978
14 301.1053 300.0980
15 301.1054 300.0981
16 301.1054 300.0981
17 301.1054 300.0981
18 301.1057 300.0984
19 301.1057 300.0984
20 301.1057 300.0984
21 301.1237 300.1164
22 301.1258 300.1185
23 301.1288 300.1215
24 301.1290 300.1217
25 301.1290 300.1217
26 301.1290 300.1217
27 301.1291 300.1218
28 301.1292 300.1219
29 301.1306 300.1233
30 301.1418 300.1345
31 301.1418 300.1345
32 301.1420 300.1347
33 301.1420 300.1347
34 301.1420 300.1347
35 301.1421 300.1348
36 301.1422 300.1349
Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/