Mascot Search Results

User                   : Jennifer
Email                  : [email protected]
Search title           : 2
MS data file           : PRT1231_JBEI_2.mgf
Database               : A-oryzae 20191108 (12205 sequences; 5465702 residues)
Timestamp              : 1 May 2025 at 20:39:04 GMT
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 20 ppm
Fragment Mass Tolerance: ± 0.1 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-FTICR
Number of queries      : 4450



Protein hits           : IGF1_BOVIN Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal


  Q2UJR1_ASPOR Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1


  TRYP_PIG Trypsin OS=Sus scrofa PE=1 SV=1


  Q2UK92_ASPOR AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1


  Q2U1V7_ASPOR ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1


  Q2UKB4_ASPOR Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1


  Q2U034_ASPOR SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1


  Q2U8R9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000317 PE=4 SV=1


  Q2UHF6_ASPOR Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1


  Q2UK62_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1


  PEPA_ASPOR Aspergillopepsin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pepA PE=1 SV=2


  Q2U2M3_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000399 PE=4 SV=1


  Q2ULR3_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000301 PE=3 SV=1


  Q2U9S4_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090166000038 PE=4 SV=1


  Q2U0S3_ASPOR MaoC-like domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000326 PE=4 SV=1


  Q2UAS1_ASPOR MFS domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000265 PE=4 SV=1


  Q2UAX0_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000199 PE=4 SV=1


  Q2UTI9_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000714 PE=4 SV=1


  Q2U9Y9_ASPOR Terpene cyclase/mutase family member OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000611 PE=3 SV=1


  Q2UU93_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000407 PE=4 SV=1


  Q2UTE7_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000048 PE=3 SV=1


  Q2U650_ASPOR Aldo_ket_red domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000379 PE=4 SV=1


  Q2UV72_ASPOR FAD_binding_3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000018 PE=4 SV=1


  Q2UMK6_ASPOR WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000719 PE=4 SV=1

Select Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score or expect cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups    Require bold red

    All queries     Unassigned     Below homology threshold     Below identity threshold

1.    IGF1_BOVIN    Mass: 42206    Score: 172    Matches: 22(8)  Sequences: 16(7)  emPAI: 1.13
 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3984   579.3165   578.3092   578.3064   4.86 0  18  0.26 1  U    K.GIDFK.E
 4031   325.6513   649.2880   649.2854   4.15 0  13  0.26 1  U    R.SCDLR.R
 4034   328.1958   654.3770   654.3741   4.51 0  (21) 0.011 1  U    R.TIFFK.D
 4035   655.3847   654.3774   654.3741   5.08 0  23  0.0081 1  U    R.TIFFK.D
 4116   395.6833   789.3520   789.3479   5.20 0  11  0.57 1  U    R.YPDHMK.Q
 4136   411.2021   820.3896   820.3868   3.48 0  8  1.9 1  U    K.QHDFFK.S
 4139   413.7119   825.4092   825.4055   4.56 0  39  0.00078 1  U    K.FICTTGK.L
 4217   328.1714   981.4924   981.4879   4.51 0  (1) 6.2 1  U    K.EDGNILGHK.L
 4218   491.7537   981.4928   981.4879   4.99 0  11  0.62 1  U    K.EDGNILGHK.L
 4254   525.7661   1049.5176   1049.5142   3.31 0  53  7e-005 1  U    K.FEGDTLVNR.I
 4328   633.7958   1265.5770   1265.5710   4.77 0  (16) 0.28 1  U    K.SAMPEGYVQER.T
 4335   641.7934   1281.5722   1281.5659   4.93 0  33  0.0042 1  U    K.SAMPEGYVQER.T 4334
 4350   449.8928   1346.6566   1346.6507   4.39 1  46  0.00038 1  U    R.TIFFKDDGNYK.T 4351
 4352   674.8370   1347.6594   1347.6347   18.4 1  (13) 0.78 1  U    R.TIFFKDDGNYK.T
 4364   479.5827   1435.7263   1435.7203   4.16 0  16  0.29 1  U    R.LEMYCAPLKPAK.S
 4372   493.2618   1476.7636   1476.7572   4.28 1  47  0.00024 1  U    R.AEVKFEGDTLVNR.I
 4375   752.3370   1502.6594   1502.6525   4.61 0  35  0.002 1  U    K.FSVSGEGEGDATYGK.L
 4380   386.4550   1541.7909   1541.7838   4.60 1  2  8.2 3  U    K.GIDFKEDGNILGHK.L
 4388   531.6170   1591.8292   1591.8214   4.88 1  3  5.6 1  U    R.RLEMYCAPLKPAK.S
 4448   895.6456   4473.1916   4473.1360   12.4 0  5  3 1  U    R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D

2.    Q2UJR1_ASPOR    Mass: 74750    Score: 137    Matches: 14(7)  Sequences: 13(7)  emPAI: 0.35
 Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4063   345.1962   688.3778   688.3755   3.34 0  19  0.29 1  U    R.VIDAGSK.V
 4074   358.2310   714.4474   714.4428   6.45 0  18  0.18 1  U    R.VAWVLK.Q
 4110   394.2336   786.4526   786.4487   5.02 0  18  0.26 1  U    R.IVDEALK.Q
 4177   448.2320   894.4494   894.4447   5.34 0  27  0.019 1  U    K.LYDESIR.S
 4205   476.7448   951.4750   951.4702   5.13 0  18  0.15 1  U    R.YWDVIEK.H
 4208   481.2659   960.5172   960.5128   4.64 0  2  9 1  U    K.VVITTDEGK.R
 4221   496.7534   991.4922   991.4876   4.72 0  36  0.0034 1  U    R.SPQTFWAR.M
 4260   533.3034   1064.5922   1064.5866   5.31 0  22  0.032 1  U    R.TITYGELLR.E
 4281   373.2136   1116.6190   1116.6139   4.55 1  30  0.0096 1  U    K.VVITTDEGKR.G
 4282   559.3168   1116.6190   1116.6139   4.62 1  (10) 0.96 1  U    K.VVITTDEGKR.G
 4306   598.2825   1194.5504   1194.5451   4.45 0  39  0.0014 1  U    R.LNAAYNCVDR.H
 4315   616.3100   1230.6054   1230.5993   4.98 0  38  0.002 1  U    R.TGTEVPWTQGR.D
 4361   704.8641   1407.7136   1407.7068   4.85 0  11  0.87 1  U    K.QCPDVTSVLVYK.R
 4386   788.3877   1574.7608   1574.7576   2.05 0  60  1.2e-005 1  U    K.VAIIYEADEPNEGR.T

3.    TRYP_PIG    Mass: 25078    Score: 133    Matches: 5(5)  Sequences: 3(3)  emPAI: 0.65
 Trypsin OS=Sus scrofa PE=1 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4148   421.7604   841.5062   841.5022   4.87 0  55  1.9e-005 1  U    R.VATVSLPR.S 4147
 4250   523.2876   1044.5606   1044.5564   4.11 0  45  0.00045 1  U    K.LSSPATLNSR.V
 4253   523.7820   1045.5494   1045.5404   8.69 0  (28) 0.029 1  U    K.LSSPATLNSR.V
 4411   738.0435   2211.1087   2211.0807   12.6 0  41  0.00095 1  U    R.LGEHNIDVLEGNEQFINAAK.I

4.    Q2UK92_ASPOR    Mass: 63866    Score: 36     Matches: 3(2)  Sequences: 3(2)  emPAI: 0.11
 AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4200   466.2685   930.5224   930.5175   5.36 0  31  0.012 1  U    R.VPYLPSQK.T
 4271   546.2761   1090.5376   1090.5329   4.40 0  20  0.14 1  U    R.TETVMLEPR.V
 4349   667.3499   1332.6852   1332.6786   4.99 0  25  0.045 1  U    R.LGQLIGGAGNYDR.G

5.    Q2U1V7_ASPOR    Mass: 35502    Score: 34     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.09
 ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4179   450.7508   899.4870   899.4937   -7.38 1  34  0.0036 1  U    K.RGANVNLR.D

6.    Q2UKB4_ASPOR    Mass: 91359    Score: 31     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.04
 Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4001   308.6881   615.3616   615.3592   4.04 0  (12) 1.5 1  U    K.ADIGIK.N
 4002   616.3710   615.3637   615.3592   7.42 0  31  0.019 1  U    K.ADIGIK.N

7.    Q2U034_ASPOR    Mass: 131681   Score: 30     Matches: 3(1)  Sequences: 3(1)  emPAI: 0.02
 SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4162   432.7345   863.4544   863.4501   5.01 0  30  0.013 1  U    R.AGDIVSFR.N
 4246   522.7853   1043.5560   1043.5512   4.64 0  14  0.68 1  U    R.HEAPPLQPR.Q
 4287   565.7797   1129.5448   1129.5363   7.53 0  1  7.9 1  U    R.NPSDATLEQR.H

8.    Q2U8R9_ASPOR    Score: 30     Matches: 2(2)  Sequences: 1(1)  emPAI: 0.26
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000317 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4034   328.1958   654.3770   654.3741   4.51 0  (21) 0.011 1  U    R.LTFFK.A
 4035   655.3847   654.3774   654.3741   5.08 0  23  0.0081 1  U    R.LTFFK.A

9.    Q2UHF6_ASPOR    Mass: 54290    Score: 27     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.06
 Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4258   530.7660   1059.5174   1059.5131   4.08 0  27  0.026 1  U    K.GDVAAAAGCLR.Y

10.   Q2UK62_ASPOR    Mass: 75289    Score: 25     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4151   423.7390   845.4634   845.4606   3.31 1  25  0.049 1  U    K.LATEQKR.H

11.   PEPA_ASPOR    Score: 25     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.07
 Aspergillopepsin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pepA PE=1 SV=2
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3977   559.3843   558.3770   558.3741   5.27 0  25  0.003 1  U    M.VILSK.V

12.   Q2U2M3_ASPOR    Mass: 71213    Score: 23     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.05
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090038000399 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4159   430.2499   858.4852   858.4811   4.87 0  23  0.062 1  U    R.IAIVNSDK.C

13.   Q2ULR3_ASPOR    Mass: 56846    Score: 23     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.06
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000301 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4159   430.2499   858.4852   858.4712   16.4 0  23  0.062 1  U    R.IAISNWR.V

14.   Q2U9S4_ASPOR    Mass: 25368    Score: 23     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.13
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090166000038 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4047   330.7007   659.3868   659.3854   2.26 0  23  0.046 1  U    R.LATNIK.G

15.   Q2U0S3_ASPOR    Score: 22     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.03
 MaoC-like domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000326 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3940   507.2965   506.2892   506.2853   7.76 0  22  0.031 1  U    K.VGGFK.T

16.   Q2UAS1_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.05
 MFS domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000265 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4023   321.7200   641.4254   641.4224   4.71 0  19  0.029 1  U    R.IILQR.S

17.   Q2UAX0_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.12
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000199 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4023   321.7200   641.4254   641.4224   4.71 0  19  0.029 1  U    R.LIIQR.K

 
      Proteins matching the same set of peptides:
      Q2UFN5_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)
18.   Q2UTI9_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.12
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000714 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4023   321.7200   641.4254   641.4224   4.71 0  19  0.029 1  U    K.ILIQR.D

19.   Q2U9Y9_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Terpene cyclase/mutase family member OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000611 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3968   525.3423   524.3350   524.3322   5.36 0  19  0.029 1  U    K.LPPAK.T

 
      Proteins matching the same set of peptides:
      Q2UF55_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)
20.   Q2UU93_ASPOR    Score: 19     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.08
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000407 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3968   525.3423   524.3350   524.3322   5.36 0  19  0.029 1  U    R.IPPAK.A

21.   Q2UTE7_ASPOR    Mass: 32098    Score: 19     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.10
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000048 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4220   494.7594   987.5042   987.4985   5.82 0  19  0.25 1  U    R.LQALDGSQR.Y

22.   Q2U650_ASPOR    Mass: 43022    Score: 18     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.08
 Aldo_ket_red domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000379 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4077   362.6683   723.3220   723.3187   4.59 0  18  0.097 1  U    K.ANQYAR.D

23.   Q2UV72_ASPOR    Mass: 72822    Score: 18     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.05
 FAD_binding_3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000018 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 4077   362.6683   723.3220   723.3187   4.59 0  18  0.097 1  U    R.ANQAYR.D

24.   Q2UMK6_ASPOR    Score: 18     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.05
 WD_REPEATS_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090001000719 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 3984   579.3165   578.3092   578.3064   4.86 0  18  0.26 1  U    K.IGDFK.S

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 3940
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.8     0.031      7.76   15   Q2U0S3_ASPOR K.VGGFK.T
 15.7      0.13      7.82                     R.AAAFK.G
  2.0         3      7.76                     R.VFGGK.A
Top scoring peptide matches to query 3968
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.8     0.029      5.36   20   Q2UU93_ASPOR R.IPPAK.A
 18.8     0.029      5.36   19   Q2U9Y9_ASPOR LPPAK
 12.1      0.13      5.36                     K.LPAPK.S
Top scoring peptide matches to query 3977
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 13 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 25.2     0.003      5.27   11   PEPA_ASPOR M.VILSK.V
 10.1     0.098      5.27                   K.LVSIK.G
 10.1     0.098      5.27                   R.LVSLK.I
 10.1     0.098      5.24                   R.LVVTK.G
 10.1     0.098      5.27                   VLSLK
 10.1     0.098      5.24                   K.VLTVK.L
  8.1      0.15      5.27                   ILVSK
Top scoring peptide matches to query 3984
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.8      0.26      4.86    1   IGF1_BOVIN   K.GIDFK.E
 17.8      0.26      4.86   24   Q2UMK6_ASPOR K.IGDFK.S
  2.0        10      4.86                     R.ADVFK.R
  2.0        10     -0.94                     K.ATIMK.M
  2.0        10      4.86                     R.DAVFK.G
  2.0        10      4.86                     K.DLGFK.S
  2.0        10      4.86                     K.GQVFK.L
  2.0        10      4.86                     K.LDGFK.G
  2.0        10      4.86                     K.SPTFK.V
Top scoring peptide matches to query 4001
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 20 indicates homology
Score greater than 27 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 12.2       1.5      4.04    6   Q2UKB4_ASPOR K.ADIGIK.N
  6.8       5.3      4.07                     R.ANAIVK.E
  6.8       5.3      4.07                     R.ANGILK.V
  5.5       7.2      4.02                     K.VQIAVS.-
  4.3       9.5      4.04                     M.VGEIAK.L
  4.3       9.5      4.07                     R.VINAAK.K
  4.3       9.5      4.07                     R.VNALAK.C
  4.3       9.5      4.04                     R.VQVAAK.L
  2.1        16    -14.18                     R.IERAK.S
  2.1        16    -14.18                     K.IQRAK.Q
Top scoring peptide matches to query 4002
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 27 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 31.4     0.019      7.42    6   Q2UKB4_ASPOR K.ADIGIK.N
 17.3      0.49      7.44                     R.ALNGLK.R
 17.3      0.49      7.42                     K.IGEGLK.R
 17.3      0.49      7.42                     R.LGEGIK.W
 15.1      0.81      7.44                     R.ANGILK.V
 15.1      0.81      7.42                     K.QGGLLK.H
 15.1      0.81    -17.38                     R.WGLLK.A
 14.7      0.89      7.42                     R.GELAVK.A
 14.7      0.89      7.42                     R.GQLIGK.G
 14.7      0.89      7.44                     K.NALAVK.D
Top scoring peptide matches to query 4023
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 19.4     0.029      4.71   16   Q2UAS1_ASPOR R.IILQR.S
 19.4     0.029      4.71   18   Q2UTI9_ASPOR K.ILIQR.D
 19.4     0.029      4.71   17   Q2UAX0_ASPOR R.LIIQR.K
 10.4      0.23      4.71                     LLVAAR
  9.3      0.29      4.71                     R.LGLLAR.L
  7.2      0.47      4.71                     K.LLIRQ.-
  7.2      0.47      4.71                     K.ILAIGR.L
  7.2      0.47      4.71                     K.ILGAIR.M
  7.2      0.47      4.71                     LIAGLR
  7.2      0.47      4.71                     K.LIGALR.A
Top scoring peptide matches to query 4031
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.3      0.26      4.15    1   IGF1_BOVIN R.SCDLR.R
 13.3      0.26      4.17                   R.SCNIR.S
  5.6       1.5      4.15                   K.SCEVR.I
  5.6       1.5      4.15                   R.SCIDR.E
Top scoring peptide matches to query 4034
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.4     0.011      4.51    8   Q2U8R9_ASPOR R.LTFFK.A
 21.4     0.011      4.51    1   IGF1_BOVIN   R.TIFFK.D
  5.5      0.41      4.51                     K.VYVFK.E
  5.5      0.41      4.51                     R.YVVFK.V
  1.4       1.1     -6.50                     R.GRPPTK.D
Top scoring peptide matches to query 4035
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.5    0.0081      5.08    8   Q2U8R9_ASPOR R.LTFFK.A
 22.5    0.0081      5.08    1   IGF1_BOVIN   R.TIFFK.D
  4.9      0.47      5.08                     K.VYVFK.E
  4.9      0.47      5.08                     R.YVVFK.V
Top scoring peptide matches to query 4047
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 22.9     0.046      2.26   14   Q2U9S4_ASPOR R.LATNIK.G
 13.1      0.44      2.26                     R.LAESIK.Y
 13.1      0.44      2.26                     K.LAQSIK.Y
  9.8      0.96      2.23                     K.IADTLK.H
  9.8      0.96      2.26                     K.IASELK.N
  9.8      0.96      2.23                     R.LTEGIK.Q
  9.7      0.98      2.23                     K.LATVQK.V
  5.2       2.7    -14.78                     R.NKSAIK.A
  4.9       2.9      2.23                     K.IGELTK.K
  4.9       2.9      2.23                     R.LGTLEK.D
Top scoring peptide matches to query 4063
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates homology
Score greater than 26 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.5      0.29      3.34    2   Q2UJR1_ASPOR R.VIDAGSK.V
 18.5      0.29      3.34                     R.VLDTNK.F
  5.4       5.9    -12.98                     K.VIQSSR.L
  5.4       5.9    -18.83                     K.VLGWSK.T
Top scoring peptide matches to query 4074
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 21 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.8      0.18      6.45    2   Q2UJR1_ASPOR R.VAWVLK.Q
  7.3         2      12.1                     R.VAQLRK.S
  6.1       2.7      12.1                     R.VAQAKAK.G
  5.3       3.2      12.1                     R.LGERLK.K
  5.3       3.2      12.1                     K.LGRELK.N
  5.0       3.4      12.1                     R.KEVIAR.M
  5.0       3.4     -3.63                     R.RTVAIR.V
  4.2       4.1      12.1                     R.VAEKLR.M
  4.2       4.1      12.1                     K.VALQKR.Y
  4.2       4.1     -3.63                     K.VALTRR.R
Top scoring peptide matches to query 4077
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.9     0.097      4.59   23   Q2UV72_ASPOR R.ANQAYR.D
 17.9     0.097      4.59   22   Q2U650_ASPOR K.ANQYAR.D
  2.5       3.4      4.55                     R.ADTFNR.G
  1.9         4      4.57                     R.AENFSR.E
Top scoring peptide matches to query 4110
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 17.5      0.26      5.02    2   Q2UJR1_ASPOR R.IVDEALK.Q
  5.7         4     -9.28                     K.LGDGKGLK.Y
  4.3       5.4      5.00                     R.IVLQVSE.-
  3.7       6.3     -9.26                     R.LVAQLSR.Y
  1.8       9.8      5.04                     K.IEINGLK.K
  1.8       9.8      5.02                     K.LEDGLIK.D
  1.8       9.8      5.02                     R.LELDGIK.V
  1.8       9.8      5.06                     R.LNNAILK.R
  1.3        11    -18.67                     -.MPGLLLK.S
  0.5        13      5.04                     K.AINDLLK.A
Top scoring peptide matches to query 4116
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 11.2      0.57      5.20    1   IGF1_BOVIN R.YPDHMK.Q
Top scoring peptide matches to query 4136
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  7.8       1.9      3.48    1   IGF1_BOVIN K.QHDFFK.S
  4.1       4.4     -0.61                   K.WMVRET.-
  0.0        11     -3.65                   K.KDSQESK.T
Top scoring peptide matches to query 4139
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 39.2   0.00078      4.56    1   IGF1_BOVIN K.FICTTGK.L
 13.9      0.26      4.57                   K.FICSATK.I
  5.2         2      4.57                   R.MIQGSFK.S
  5.1         2      0.51                   R.KMMTTAK.F
  2.0       4.1    -16.94                   R.SFSVTSAK.N
  1.5       4.6     -9.03                   K.TMVHPNK.Q
Top scoring peptide matches to query 4147
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 45.2   0.00019      4.63    3   TRYP_PIG R.VATVSLPR.S
  9.9      0.62     -8.70                 R.ITRSIPR.E
  5.8       1.6     -8.70                 K.VDRIALR.R
  5.4       1.8      4.67                 K.LQKSLPR.Y
  3.4       2.8     -8.70                 R.VAVLERR.D
  1.5       4.3      4.63                 K.VLQVLDR.V
  0.0       6.1     -8.68                 R.VAALNARK.A
  0.0       6.1      4.65                 K.LSLGLSPR.S
Top scoring peptide matches to query 4148
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 55.2  1.9e-005      4.87    3   TRYP_PIG R.VATVSLPR.S
 11.6      0.43     -8.46                 K.VDRIALR.R
 10.9       0.5      4.89                 K.LSLGLSPR.S
  9.0      0.77     -8.46                 R.ITRSIPR.E
  9.0      0.77      4.90                 K.LQKSLPR.Y
  6.9       1.3     -8.46                 R.VAVLERR.D
  6.3       1.5      18.2                 K.VLGTLPDK.G
  4.1       2.4      4.87                 K.VSGTLPLR.F
  3.8       2.6      4.87                 R.AVLPVSTR.S
  1.9         4      4.89                 R.GLILSPSR.E
Top scoring peptide matches to query 4151
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 25.3     0.049      3.31   10   Q2UK62_ASPOR K.LATEQKR.H
  2.4       9.5      16.6                     R.IAKEEQK.E
  2.4       9.5      3.29                     K.LAKDGASGK.K
  2.4       9.6      16.6                     R.ALTGDEIK.E
  2.4       9.6      3.28                     R.ALTGDLTR.D
  0.8        14      16.6                     R.ALETIGDK.T
  0.8        14      11.0                     R.IAARMQR.Y
  0.8        14      16.6                     LAEEKEK
  0.8        14    -18.74                     R.LALSVMGR.M
  0.8        14      16.6                     R.LAQEKEK.A
Top scoring peptide matches to query 4159
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 23.3     0.062      16.4   13   Q2ULR3_ASPOR R.IAISNWR.V
 23.3     0.062      4.87   12   Q2U2M3_ASPOR R.IAIVNSDK.C
  9.5       1.5     -8.21                     R.LANTQGKK.A
  1.3       9.8    -12.90                     R.LLATQWK.G
Top scoring peptide matches to query 4162
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 24 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.1     0.013      5.01    7   Q2U034_ASPOR R.AGDIVSFR.N
  9.4       1.5      14.2                     R.DKLTMEK.D
  5.9       3.4      5.03                     K.AGVLNFSR.E
  1.8       8.8      5.03                     K.DAAVAVYR.E
  1.8       8.8      5.03                     K.LDKGEFR.L
  1.8       8.8      5.05                     R.NLEGYLR.R
  1.8       8.8      16.5                     R.REAFWR.Q
  1.6       9.2      5.01                     K.DQVLFSR.F
  1.6       9.2      5.01                     M.GSVYSPVR.E
  1.6       9.2      1.14                     R.NKVLMSR.K
Top scoring peptide matches to query 4177
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.0     0.019      5.34    2   Q2UJR1_ASPOR K.LYDESIR.S
  4.4       3.5      5.34                     R.LYADAQSK.A
  3.7       4.1      17.9                     R.YLDDLQK.Q
  3.0       4.8    -15.49                     R.EMAFILR.N
  1.7       6.6      5.36                     K.IQSNYLR.G
  1.7       6.6    -15.49                     R.LFMAQIR.Q
  1.7       6.6      5.34                     K.LSYEDIR.F
  0.8       7.9    -11.74                     M.PFFSQLR.R
  0.8       7.9      5.34                     R.QVYESLR.A
  0.7       8.1    -15.49                     R.ILFEAMR.G
Top scoring peptide matches to query 4179
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 33.6    0.0036     -7.38    5   Q2U1V7_ASPOR K.RGANVNLR.D
 11.2      0.63     -7.39                     K.RQDIVNR.F
 10.9      0.68     -7.38    5   Q2U1V7_ASPOR K.RGANVNLR.D
  6.1         2      5.11                     R.RQPLTER.I
  5.2       2.5      0.61                     R.VEWPTLR.M
  5.2       2.5      17.6                     K.VTEDPALR.L
  4.4       3.1      5.11                     K.RQQTIPR.Y
  3.1         4     -7.41                     RGDVAVQR
  2.7       4.5      12.4                     K.RTMHSLR.E
  1.5         6     -7.38                     R.QRQQALR.L
Top scoring peptide matches to query 4200
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.6     0.012      5.36    4   Q2UK92_ASPOR R.VPYLPSQK.T
  1.6       9.3    -10.33                     K.TPIMIGKR.K
  0.4        12      16.7                     R.KCVAAVQR.D
Top scoring peptide matches to query 4205
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.5      0.15      5.13    2   Q2UJR1_ASPOR R.YWDVIEK.H
Top scoring peptide matches to query 4208
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  1.8         9      4.64    2   Q2UJR1_ASPOR K.VVITTDEGK.R
Top scoring peptide matches to query 4217
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  1.1       6.2      4.51    1   IGF1_BOVIN K.EDGNILGHK.L
Top scoring peptide matches to query 4218
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 11.1      0.62      4.99    1   IGF1_BOVIN K.EDGNILGHK.L
Top scoring peptide matches to query 4220
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.6      0.25      5.82   21   Q2UTE7_ASPOR R.LQALDGSQR.Y
  3.8       7.5      5.83                     R.AQLDQERK.E
  2.5        10      5.83                     R.NVEDNLRK.E
  2.2        11    -19.63                     R.LSIIQQER.D
  2.2        11    -19.65                     R.QPSLSIQSK.M
  1.9        12     -5.54                     R.AEIESRQR.R
  0.6        16      17.2                     R.VDELDLQR.L
  0.6        16      5.80                     K.VDGDGKIER.L
  0.6        16      5.80                     K.VDKGDVEAR.L
  0.6        16      17.2                     K.VDLNEIER.V
Top scoring peptide matches to query 4221
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 36.0    0.0034      4.72    2   Q2UJR1_ASPOR R.SPQTFWAR.M
  2.3         8      16.7                     K.IAQQSASMR.W
  0.0        14     -8.65                     R.IAMSTGLGDK.A
Top scoring peptide matches to query 4246
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 15 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 13.9      0.68      4.64    7   Q2U034_ASPOR R.HEAPPLQPR.Q
  1.4        12      15.4                     R.HELQGLYGK.N
Top scoring peptide matches to query 4250
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 45.2   0.00045      4.11    3   TRYP_PIG K.LSSPATLNSR.V
  9.8       1.5    -10.51                 K.LSSHFVSIR.K
  2.3       8.7     -2.97                 R.LDEMVAVIR.D
  1.9       9.6     -2.96                 K.MSLELSPIR.V
  0.8        12      4.10                 K.RLNTGGTTPK.N
  0.7        13      0.27                 R.LSELEWIR.G
  0.5        13      4.13                 K.KSAPSASQLR.K
Top scoring peptide matches to query 4253
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 20 indicates homology
Score greater than 25 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 27.5     0.029      8.69    3   TRYP_PIG K.LSSPATLNSR.V
  5.5       4.6      1.63                 K.IGVIMAEANK.K
  4.9       5.3    -19.88                 R.LSGIMRTPR.S
  3.6       7.1    -15.36                 K.LSSALALDEK.D
  0.2        16      8.69                 R.LRELSDADK.S
Top scoring peptide matches to query 4254
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 52.5    7e-005      3.31    1   IGF1_BOVIN K.FEGDTLVNR.I
 10.9         1     -7.39                   R.FEVETGGRR.W
  8.2       1.9      14.0                   R.FDDAVNIQK.V
  1.2       9.4     -7.36                   K.YLNGKGNGAR.Y
  1.1       9.7     -7.36                   K.FEESRNLR.K
  1.1       9.7      10.8                   R.MEKVLDNGK.T
  0.9        10    -10.59                   -.MEQTTRIR.K
  0.1        12      3.35                   R.EFNNRLAGK.D
Top scoring peptide matches to query 4258
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 27.1     0.026      4.08    9   Q2UHF6_ASPOR K.GDVAAAAGCLR.Y
  3.5         6     -6.49                     R.AAMASRNAPR.L
  3.5         6    -16.45                     R.FIAEQEAPR.R
  3.5         6      7.28                     K.FRPSNDAPR.E
  3.5         6    -16.47                     R.GLTAIWEDR.Q
  3.5         6      14.7                     R.MNLENVAPR.L
  3.5         6      14.7                     R.MNLENVAPR.L
Top scoring peptide matches to query 4260
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.8     0.032      5.31    2   Q2UJR1_ASPOR R.TITYGELLR.E
Top scoring peptide matches to query 4271
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 20.3      0.14      4.40    4   Q2UK92_ASPOR R.TETVMLEPR.V
Top scoring peptide matches to query 4281
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 30.3    0.0096      4.55    2   Q2UJR1_ASPOR K.VVITTDEGKR.G
Top scoring peptide matches to query 4282
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 10.2      0.96      4.62    2   Q2UJR1_ASPOR K.VVITTDEGKR.G
Top scoring peptide matches to query 4287
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 13 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  0.7       7.9      7.53    7   Q2U034_ASPOR R.NPSDATLEQR.H
Top scoring peptide matches to query 4306
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 38.8    0.0014      4.45    2   Q2UJR1_ASPOR R.LNAAYNCVDR.H
  0.8       8.8      11.0                     K.SMGQLEVEMR.-
Top scoring peptide matches to query 4315
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 21 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 38.2     0.002      4.98    2   Q2UJR1_ASPOR R.TGTEVPWTQGR.D
  6.2       3.2    -15.44                     R.TVIGGNWDQIK.E
Top scoring peptide matches to query 4328
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 15.6      0.28      4.77    1   IGF1_BOVIN K.SAMPEGYVQER.T
  0.1       9.9     -9.27                   K.TAQGVQNLYDR.M
Top scoring peptide matches to query 4334
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.2      0.43      3.84    1   IGF1_BOVIN K.SAMPEGYVQER.T
Top scoring peptide matches to query 4335
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 18 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 33.2    0.0042      4.93    1   IGF1_BOVIN K.SAMPEGYVQER.T
  3.7       3.8    -12.25                   R.LMQTVVCQMR.F
  2.8       4.7     -1.20                   R.QEHPSNWDLR.Q
  2.8       4.7     -1.20                   R.QEHPSNWDLR.Q
Top scoring peptide matches to query 4349
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 24.9     0.045      4.99    4   Q2UK92_ASPOR R.LGQLIGGAGNYDR.G
Top scoring peptide matches to query 4350
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 18 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 45.7   0.00038      4.39    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  3.0       7.2     -3.44                   R.EGMLAEQERLR.A
  1.0        11    -13.80                   R.TASLCQEITVPK.T
  0.8        12      18.7                   K.QGGGSETSALPTNK.D
  0.8        12      7.39                   K.WDNLDSAALNTK.Y
Top scoring peptide matches to query 4351
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 13.7      0.61      4.61    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  3.7       6.1     -3.22                   R.EGMLAEQERLR.A
  1.8       9.6    -13.58                   R.TASLCQEITVPK.T
Top scoring peptide matches to query 4352
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 15 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 12.9      0.78      18.4    1   IGF1_BOVIN R.TIFFKDDGNYK.T
  1.9       9.8      1.71                   R.NTWASTWEVVR.M
  0.4        14    -10.98                   R.SVNIDSGANKSTR.D
Top scoring peptide matches to query 4361
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 14 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 11.2      0.87      14.8                     R.LEHGQLVMDPNR.F
 11.2      0.87      4.85    2   Q2UJR1_ASPOR K.QCPDVTSVLVYK.R
  0.6        10      3.10                     K.GKSDITITNQTTK.I
Top scoring peptide matches to query 4364
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 16.0      0.29      4.16    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
Top scoring peptide matches to query 4372
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 47.2   0.00024      4.28    1   IGF1_BOVIN R.AEVKFEGDTLVNR.I
 10.8         1      13.7                   R.QNLAKGINHNNPR.T
 10.8         1      13.7                   R.QNLAKGINHNNPR.T
 10.8         1      13.7                   R.QNLAKGINHNNPR.T
 10.8         1      13.7                   R.QNLAKGINHNNPR.T
  2.4       7.2      13.7                   K.TPRSQHGPNLNVR.S
  0.9        10      8.72                   R.DPHRQPNIIVMR.A
  0.4        11      13.7                   R.QNLAKGINHNNPR.T
  0.4        11      13.7                   R.QNLAKGINHNNPR.T
Top scoring peptide matches to query 4375
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 35.4     0.002      4.61    1   IGF1_BOVIN K.FSVSGEGEGDATYGK.L
  1.2       5.3    -12.58                   -.MSAGGEHLKDEGTR.R
Top scoring peptide matches to query 4380
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 15 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  4.4       4.6     -9.10                   R.GVSPLTQAQISEGVR.T
  3.1       6.2     -9.10                   R.GVSPLTQAQISEGVR.T
  2.0       8.2      17.0                   R.DQLASMQPSIIPPK.R
  2.0       8.2      4.60    1   IGF1_BOVIN K.GIDFKEDGNILGHK.L
  1.4       9.3    -13.88                   R.QLDPSEKPILMQK.E
Top scoring peptide matches to query 4386
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 20 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 60.4  1.2e-005      2.05    2   Q2UJR1_ASPOR K.VAIIYEADEPNEGR.T
  3.6       5.6      15.5                     R.TAGIWGDWENALDK.N
  2.5       7.2      4.60                     R.NAVRSATDAGQLEDK.V
Top scoring peptide matches to query 4388
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  3.3       5.6      4.88    1   IGF1_BOVIN R.RLEMYCAPLKPAK.S
Top scoring peptide matches to query 4411
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 41.2   0.00095      12.6    3   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
 41.2   0.00095      12.6    3   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
 22.1     0.077      12.6    3   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
  3.1       6.2      12.6    3   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
  2.2       7.5      16.7                 K.LPNGMPFGHRLWCEIQVR.E
Top scoring peptide matches to query 4448
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  4.8         3      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  4.8         3      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  4.8         3      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  4.8         3      12.4    1   IGF1_BOVIN R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D
  3.1       4.4    -10.55                   K.YISSNITQTLAVPGLEAGMRHAFENLWPVLMALPDFLAER.K
  3.0       4.4     -6.36                   K.QQLSLARSGQAYSGPAEGSYNTPSGPVLPSQFTEPLSVNPVSR.T