MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1231_JBEI_2.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:39:04 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,450

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 17)


Page: 1 2 Next 

-1

Accession Score Description
1 IGF1_BOVIN 172 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
Score Mass Matches Sequences emPAI
1.1 IGF1_BOVIN 172 42206 22 (10) 16 (8) 1.13
Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
2 samesets of IGF1_BOVIN
GFP_AEQVI 172 26983 19 (10) 13 (8) 2.21
Green fluorescent protein OS=Aequorea victoria GN=GFP PE=1 SV=1
B7UCZ6_9RHAB 172 85329 19 (10) 13 (8) 0.46
G protein/GFP fusion protein OS=Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP OX=582817 GN=G PE=3 SV=1

-22 peptide matches (20 non-duplicate, 2 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
3984   579.3165 578.3092 578.3064 4.86 0 18 0.033 +1Score > 25 indicates identity
Score > 15 indicates homology
U K.GIDFK.E
4031   325.6513 649.2880 649.2854 4.15 0 13 0.19 +1Score > 20 indicates identity
Score > 19 indicates homology
U R.SCDLR.R
4034   328.1958 654.3770 654.3741 4.51 0 21 0.011 +1Score > 14 indicates identity U R.TIFFK.D
4035   655.3847 654.3774 654.3741 5.08 0 23 0.0081 +1Score > 14 indicates identity U R.TIFFK.D
4116   395.6833 789.3520 789.3479 5.20 0 11 0.57 +1Score > 21 indicates identity U R.YPDHMK.Q
4136   411.2021 820.3896 820.3868 3.48 0 8 0.48 +1Score > 23 indicates identity
Score > 17 indicates homology
U K.QHDFFK.S
4139   413.7119 825.4092 825.4055 4.56 0 39 0.00078 +1Score > 21 indicates identity U K.FICTTGK.L
4217   328.1714 981.4924 981.4879 4.51 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
U K.EDGNILGHK.L
4218   491.7537 981.4928 981.4879 4.99 0 11 0.62 +1Score > 21 indicates identity U K.EDGNILGHK.L
4254   525.7661 1049.5176 1049.5142 3.31 0 53 7e-005 +1Score > 23 indicates identity U K.FEGDTLVNR.I
4328   633.7958 1265.5770 1265.5710 4.77 0 16 0.035 +1Score > 23 indicates identity
Score > 14 indicates homology
U K.SAMPEGYVQER.T
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_2.raw

Score > 22 indicates identity

Score > 18 indicates homology

4335 +1 641.7934 1281.5722 1281.5659 4.93 0 33 0.0017 -1Score > 22 indicates identity
Score > 18 indicates homology
U K.SAMPEGYVQER.T + Oxidation (M)
-12.3 0 4 1.5 2 LMQTVVCQMR   + Deamidated (NQ); Oxidation (M)
-1.20 0 3 1.9 3 QEHPSNWDLR   + Deamidated (NQ)
-1.20 0 3 1.9 3 QEHPSNWDLR   + Deamidated (NQ)
4350 +1 449.8928 1346.6566 1346.6507 4.39 1 46 0.0001 +1Score > 24 indicates identity
Score > 18 indicates homology
U R.TIFFKDDGNYK.T
4352   674.8370 1347.6594 1347.6347 18.4 1 13 0.095 +1Score > 24 indicates identity
Score > 15 indicates homology
U R.TIFFKDDGNYK.T + Deamidated (NQ)
4364   479.5827 1435.7263 1435.7203 4.16 0 16 0.29 +1Score > 23 indicates identity U R.LEMYCAPLKPAK.S + Oxidation (M)
4372   493.2618 1476.7636 1476.7572 4.28 1 47 0.00024 +1Score > 23 indicates identity U R.AEVKFEGDTLVNR.I
4375   752.3370 1502.6594 1502.6525 4.61 0 35 0.00062 +1Score > 21 indicates identity
Score > 16 indicates homology
U K.FSVSGEGEGDATYGK.L
4380   386.4550 1541.7909 1541.7838 4.60 1 2 1 +3Score > 24 indicates identity
Score > 15 indicates homology
U K.GIDFKEDGNILGHK.L
4388   531.6170 1591.8292 1591.8214 4.88 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
U R.RLEMYCAPLKPAK.S + Oxidation (M)
4448   895.6456 4473.1916 4473.1360 12.4 0 5 0.69 +1Score > 22 indicates identity
Score > 16 indicates homology
U R.HNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSK.D + 2 Deamidated (NQ)

2 subsets and intersections (2 subset proteins in total)

Score Mass Subset of
Q2U8R9_ASPOR 30 0 1.1
description
Q2UMK6_ASPOR 18 0 1.1
description

+2

Accession Score Description
1 Q2UJR1_ASPOR 137 Acetyl-coenzyme A synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003001112 PE=3 SV=1

+3

Accession Score Description
1 TRYP_PIG 133 Trypsin OS=Sus scrofa PE=1 SV=1

+4

Accession Score Description
1 Q2UK92_ASPOR 36 AlcB domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000906 PE=4 SV=1

+5

Accession Score Description
1 Q2U1V7_ASPOR 34 ANK_REP_REGION domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000080 PE=4 SV=1

+6

Accession Score Description
1 Q2UKB4_ASPOR 31 Urease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000879 PE=3 SV=1

+7

Accession Score Description
1 Q2U034_ASPOR 30 SH3 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000606 PE=4 SV=1

+8

Accession Score Description
1 Q2UHF6_ASPOR 27 Aldedh domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000467 PE=3 SV=1

+9

Accession Score Description
1 Q2UK62_ASPOR 25 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000939 PE=4 SV=1

+10

Accession Score Description
1 PEPA_ASPOR 25 description
Page: 1 2 Next 

Not what you expected? Try the select summary.