MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1231_JBEI_1.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:38:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,476

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4447)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2215 412.2446 822.4746 822.4712 4.22 0 0 3.1 +1Score > 18 indicates identity VIHQLGR + Deamidated (NQ)
4293 935.6223 5607.6901 5607.7654 -13.4 1 0 4.7 +1Score > 19 indicates identity DSGQELIMELISEFPHYASTHGLLGLLGPHLAECLTGKSDPVSLLFGSDQGR + Oxidation (M)
3017 858.3704 1714.7262 1714.7477 -12.5 1 0 3.6 +1Score > 18 indicates identity EMSTPKDQVACMFR + Oxidation (M)
4004 793.1635 3960.7811 3960.7056 19.1 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 NACPGGGACGGMYTANTMATAIETIGMTLPGSSSNPAESR + Deamidated (NQ)
2770 513.5777 1537.7113 1537.7372 -16.9 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 TNPDSNPPPKINSR + 2 Deamidated (NQ)
2980 337.9861 1684.8941 1684.8784 9.34 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LQTWNPEEIARSLK + Deamidated (NQ)
2207 410.2281 818.4416 818.4498 -9.90 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 KNETLSK
3669 680.8607 2719.4137 2719.4075 2.28 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 NALLVASHCGNEEIVELLLQRNAR + Deamidated (NQ)
3869 615.4701 3686.7769 3686.7261 13.8 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 KIVANMTMSNNDMVALFPDVIECMNLPSLEIK + 2 Deamidated (NQ); 3 Oxidation (M)
2480 375.8826 1124.6260 1124.6091 15.0 1 0 4.3 +1Score > 19 indicates identity RVATGYPPHK
4140 771.3743 5392.5692 5392.5708 -0.29 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 AETAMQAGNLVPDSLILELISSEFQSKGWLSASSNSSISSNASFILDGFPR + 5 Deamidated (NQ); Oxidation (M)
4426 955.7100 7637.6218 7637.6822 -7.91 1 0 2 +1Score > 16 indicates identity SAGGNIGYIVMCQIFIAFGGGTLVIGQDMAVMAASDREGVPMMLSMIGLFSSLGGAIGNAASAAIFSNTFPSALR + Deamidated (NQ); 5 Oxidation (M)
3050 581.5898 1741.7476 1741.7431 2.57 0 0 4.8 +1Score > 19 indicates identity DPENGPGWPSLNEDSK + Deamidated (NQ)
3925 641.3257 3841.9105 3841.8610 12.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 TTMDVDCPPWLDWVHGGLQFQAIHHLYPRVPR + Deamidated (NQ)
2511 598.8040 1195.5934 1195.5873 5.15 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 DPNLAYIAYR + Deamidated (NQ)
3217 655.2667 1962.7783 1962.7876 -4.77 0 0 1.1 +1Score > 13 indicates identity IEMGFDCTNYQHQFR + 2 Deamidated (NQ); Oxidation (M)
2975 562.2619 1683.7639 1683.7774 -8.03 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GMLDQTEIDNKTFR + Deamidated (NQ); Oxidation (M)
1995 318.1988 634.3830 634.3802 4.41 0 0 3.5 +1Score > 18 indicates identity VFLTR
4270 934.6572 5601.8995 5601.8618 6.74 0 0 1.7 +1Score > 15 indicates identity DLSAGETIVEASIQAFGPNIDILVNNAGVEVVKPLSDLTVEDYNLVYDLNVR + Deamidated (NQ)
3020 430.4752 1717.8717 1717.8496 12.9 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 RRPTGQDYPLTSGNR + Deamidated (NQ)
2914 550.5906 1648.7500 1648.7589 -5.40 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 MAPENMKQWTVQGK + 2 Deamidated (NQ)
2691 485.2482 1452.7228 1452.7143 5.81 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MQNIAHKPGDVAR + Deamidated (NQ); Oxidation (M)
4309 803.4259 5616.9304 5617.0020 -12.7 1 0 1.4 +1Score > 14 indicates identity LGGHENPIYMRTTSLLLPLPTPDFSMPYNVIILTSTVIALAFGSIFNLLVR + 2 Deamidated (NQ)
3370 556.7581 2223.0033 2223.0114 -3.64 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ENAEVVADTASVSGGCPFSGAAK
2622 460.5627 1378.6663 1378.6728 -4.76 0 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 GAQTYNDLIQQK + Deamidated (NQ)
1 300.8920 299.8847
2 301.1416 300.1343
3 301.1417 300.1344
4 301.1418 300.1345
5 301.1418 300.1345
6 301.1419 300.1346
7 301.1420 300.1347
8 301.1420 300.1347
9 301.1421 300.1348
10 301.1422 300.1349
11 301.1422 300.1349
12 301.1422 300.1349
13 301.1422 300.1349
14 301.1422 300.1349
15 301.1422 300.1349
16 301.1422 300.1349
17 301.1423 300.1350
18 301.1423 300.1350
19 301.1423 300.1350
20 301.1424 300.1351
21 301.1424 300.1351
22 301.1424 300.1351
23 301.1425 300.1352
24 301.1425 300.1352
25 301.1425 300.1352
26 301.1425 300.1352
27 301.1426 300.1353
28 301.1427 300.1354
29 301.1427 300.1354
30 301.1428 300.1355
31 301.1428 300.1355
32 301.1428 300.1355
33 301.1428 300.1355
34 301.1429 300.1356
35 301.1429 300.1356
36 301.2209 300.2136
37 301.9107 300.9034
38 301.9108 300.9035
39 301.9109 300.9036
40 301.9109 300.9036
41 301.9111 300.9038
42 301.9111 300.9038
43 301.9111 300.9038
44 301.9111 300.9038
45 301.9112 300.9039
46 301.9117 300.9044
47 302.0715 301.0642
48 302.0715 301.0642
49 302.1970 301.1897
50 302.8692 301.8619
51 302.8693 301.8620
52 302.8695 301.8622
53 302.8696 301.8623
54 302.8697 301.8624
55 303.0608 302.0535
56 303.0609 302.0536
57 303.0612 302.0539
58 303.0613 302.0540
59 303.0649 302.0576
60 305.0103 304.0030
61 305.0103 304.0030
62 305.0104 304.0031
63 305.0106 304.0033
64 305.0107 304.0034
65 305.0107 304.0034
66 305.0108 304.0035
67 305.0108 304.0035
68 305.0108 304.0035
69 305.0108 304.0035
70 305.0109 304.0036
71 305.0109 304.0036
72 305.0109 304.0036
73 305.0110 304.0037
74 305.0110 304.0037
75 305.0110 304.0037
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/