Mascot Search Results

User                   : Jennifer
Email                  : [email protected]
Search title           : 1
MS data file           : PRT1231_JBEI_1.mgf
Database               : A-oryzae 20191108 (12205 sequences; 5465702 residues)
Timestamp              : 1 May 2025 at 20:38:15 GMT
Enzyme                 : Trypsin
Fixed modifications    : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ),Oxidation (M)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 20 ppm
Fragment Mass Tolerance: ± 0.1 Da
Max Missed Cleavages   : 1
Instrument type        : ESI-FTICR
Number of queries      : 4476



Protein hits           : IGF1_BOVIN Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal


  TRYP_PIG Trypsin OS=Sus scrofa PE=1 SV=1


  Q2UG34_ASPOR DUF1279 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000996 PE=4 SV=1


  Q2UHT2_ASPOR PWWP domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000322 PE=4 SV=1


  Q2UT39_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000170 PE=4 SV=1


  Q2TXG3_ASPOR PKS_AT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000156 PE=3 SV=1


  Q2U1P7_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000147 PE=4 SV=1


  Q2TYT6_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090103000116 PE=4 SV=1


  Q2U7W3_ASPOR PH domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000677 PE=4 SV=1


  Q2UGG1_ASPOR ACT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000854 PE=4 SV=1


  UBA4_ASPOR Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=uba4 PE=3 SV=1


  Q2TZD1_ASPOR Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000903 PE=4 SV=1


  AT222_ASPOR Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg22-2 PE=3 SV=2


  Q2UA72_ASPOR 5'-3' exoribonuclease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000515 PE=3 SV=1


  Q2UQD7_ASPOR DNA polymerase epsilon catalytic subunit OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001292 PE=3 SV=1

Select Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score or expect cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups    Require bold red

    All queries     Unassigned     Below homology threshold     Below identity threshold

1.    IGF1_BOVIN    Mass: 42206    Score: 166    Matches: 11(7)  Sequences: 7(5)  emPAI: 0.70
 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2033   325.6506   649.2866   649.2854   1.99 0  36  0.0016 1  U    R.SCDLR.R
 2655   710.8715   1419.7284   1419.7254   2.16 0  (1) 9.3 1  U    R.LEMYCAPLKPAK.S
 2656   474.2508   1419.7306   1419.7254   3.65 0  37  0.0025 1  U    R.LEMYCAPLKPAK.S
 2781   776.8482   1551.6818   1551.6810   0.54 0  31  0.0062 1  U    R.APQTGIVDECCFR.S
 2819   526.9399   1577.7979   1577.7945   2.12 1  22  0.081 1  U    R.LEMYCAPLKPAKSA.-
 2942   834.3970   1666.7794   1666.7740   3.29 0  (59) 1.6e-005 1  U    R.GFYFNKPTGYGSSSR.R
 2946   556.6008   1666.7806   1666.7740   3.96 0  61  9e-006 1  U    R.GFYFNKPTGYGSSSR.R
 2954   556.9336   1667.7790   1667.7580   12.6 0  (41) 0.00098 1  U    R.GFYFNKPTGYGSSSR.R
 3004   570.2719   1707.7939   1707.7821   6.88 1  (5) 4.1 1  U    R.RAPQTGIVDECCFR.S
 3005   570.6037   1708.7893   1708.7661   13.5 1  29  0.016 1  U    R.RAPQTGIVDECCFR.S
 3113   456.9768   1823.8781   1823.8591   10.4 1  1  9.6 1  U    R.GFYFNKPTGYGSSSRR.A

2.    TRYP_PIG    Mass: 25078    Score: 146    Matches: 8(5)  Sequences: 4(2)  emPAI: 0.46
 Trypsin OS=Sus scrofa PE=1 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2234   421.7596   841.5046   841.5022   2.97 0  50  6.1e-005 1  U    R.VATVSLPR.S 2236 2237 2238
 2432   523.2875   1044.5604   1044.5564   3.92 0  54  5.4e-005 1  U    K.LSSPATLNSR.V 2431
 3355   737.7084   2210.1034   2210.0967   3.01 0  20  0.14 1  U    R.LGEHNIDVLEGNEQFINAAK.I
 3428   762.0709   2283.1909   2283.1569   14.9 0  3  4 1  U    K.IITHPNFNGNTLDNDIMLIK.L

3.    Q2UG34_ASPOR    Score: 36     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.12
 DUF1279 domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000996 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2033   325.6506   649.2866   649.2853   2.02 0  36  0.0016 1  U    R.SCNIR.S

4.    Q2UHT2_ASPOR    Mass: 66775    Score: 31     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.05
 PWWP domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000322 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2060   672.4063   671.3990   671.3966   3.60 0  31  0.011 1  U    K.LSSIPR.D
 2062   336.7069   671.3992   671.3966   3.94 0  (20) 0.15 3  U    K.LSSIPR.D

5.    Q2UT39_ASPOR    Mass: 66674    Score: 31     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.05
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005000170 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2060   672.4063   671.3990   671.3966   3.60 0  31  0.011 1  U    K.SISLPR.K
 2062   336.7069   671.3992   671.3966   3.94 0  (20) 0.15 3  U    K.SISLPR.K

6.    Q2TXG3_ASPOR    Mass: 225144   Score: 27     Matches: 4(1)  Sequences: 3(1)  emPAI: 0.01
 PKS_AT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000156 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2237   421.7600   841.5054   841.5134   -9.39 1  6  1.7 8  U    R.VAALNARK.A 2234
 2410   505.2711   1008.5276   1008.5426   -14.84 0  27  0.019 1  U    R.MVLSVAAYR.E
 4294   802.2421   5608.6438   5608.6169   4.79 1  3  2.5 2  U    R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E

7.    Q2U1P7_ASPOR    Mass: 83761    Score: 26     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.04
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000147 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 1958   307.7165   613.4184   613.4163   3.54 0  26  0.0058 1  U    R.VAALIK.E

 
      Proteins matching the same set of peptides:
      Q2UAE4_ASPOR    Mass: 83718    Score: 26     Matches: 1(1)  Sequences: 1(1)
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000424 PE=4 SV=1
      Q2UEJ0_ASPOR    Mass: 101077   Score: 26     Matches: 1(1)  Sequences: 1(1)
 Coatomer subunit gamma OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090026000599 PE=3 SV=1
8.    Q2TYT6_ASPOR    Mass: 58936    Score: 25     Matches: 2(1)  Sequences: 1(1)  emPAI: 0.06
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090103000116 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2060   672.4063   671.3990   671.3966   3.62 0  (23) 0.073 3  U    R.AQAILR.I
 2062   336.7069   671.3992   671.3966   3.96 0  25  0.044 1  U    R.AQAILR.I

9.    Q2U7W3_ASPOR    Mass: 168122   Score: 22     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.02
 PH domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000677 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2129   364.2279   726.4412   726.4388   3.35 0  22  0.031 1  U    R.IQLTPR.A

10.   Q2UGG1_ASPOR    Score: 20     Matches: 1(1)  Sequences: 1(1)  emPAI: 0.09
 ACT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000854 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2129   364.2279   726.4412   726.4388   3.35 0  20  0.043 2  U    R.VAATLPR.F

11.   UBA4_ASPOR    Mass: 50438    Score: 20     Matches: 2(0)  Sequences: 1(0)  emPAI: 0.07
 Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=uba4 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2427   349.1936   1044.5590   1044.5451   13.3 0  (8) 2.2 2  U    R.LGNDSQIAVK.R
 2428   523.2870   1044.5594   1044.5451   13.7 0  20  0.14 1  U    R.LGNDSQIAVK.R

12.   Q2TZD1_ASPOR    Mass: 165897   Score: 20     Matches: 2(0)  Sequences: 1(0)  emPAI: 0.02
 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000903 PE=4 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2427   349.1936   1044.5590   1044.5451   13.3 1  (19) 0.19 1  U    K.KTSLDEPGAK.D
 2428   523.2870   1044.5594   1044.5451   13.7 1  20  0.14 2  U    K.KTSLDEPGAK.D

13.   AT222_ASPOR    Mass: 65596    Score: 19     Matches: 2(0)  Sequences: 2(0)  emPAI: 0.05
 Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg22-2 PE=3 SV=2
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2237   421.7600   841.5054   841.5022   3.92 0  6  1.6 7  U    K.VSGTLPLR.F
 2543   624.3257   1246.6368   1246.6339   2.33 1  19  0.19 1  U    R.EGVAMAQRLEK.G

14.   Q2UA72_ASPOR    Mass: 159438   Score: 16     Matches: 1(0)  Sequences: 1(0)  emPAI: 0.02
 5'-3' exoribonuclease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000515 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2315   905.4288   904.4215   904.4185   3.34 0  16  0.28 1  U    R.GAVAGMGNGR.G

15.   Q2UQD7_ASPOR    Mass: 259278   Score: 14     Matches: 2(0)  Sequences: 1(0)  emPAI: 0.01
 DNA polymerase epsilon catalytic subunit OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090005001292 PE=3 SV=1
      Query  Observed  Mr(expt)  Mr(calc)   ppm  Miss Score Expect Rank Unique  Peptide
 2451   542.7924   1083.5702   1083.5560   13.1 0  14  0.34 1  U    R.DVQGLPNVDK.I
 2453   543.2842   1084.5538   1084.5401   12.7 0  (9) 1.2 1  U    R.DVQGLPNVDK.I

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1958
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 16 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.2    0.0058      3.54    7   Q2U1P7_ASPOR VAALIK
 12.3      0.14      3.54                     R.ALAVLK.W
 11.8      0.16      3.54                     K.AIGLLK.K
  8.4      0.35      3.49                     K.VVGVIK.R
  4.9      0.77      3.54                     K.LGLALK.R
  1.0       1.9      3.54                     R.QILIK.G
  1.0       1.9      3.54                     R.QLLIK.L
  0.2       2.3      3.54                     K.GLIIAK.T
  0.0       2.4      3.54                     R.IQILK.R
  0.0       2.4      3.54                     IQLLK
Top scoring peptide matches to query 2033
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 36.1    0.0016      1.99    1   IGF1_BOVIN   R.SCDLR.R
 36.1    0.0016      2.02    3   Q2UG34_ASPOR R.SCNIR.S
 17.7      0.11      1.99                     K.SCEVR.I
 17.7      0.11      1.99                     R.SCIDR.E
  5.0       2.1      2.02                     R.CNSIR.I
  2.2         4      2.02                     R.SLCNR.L
  2.2         4      2.02                     K.SMEQR.S
  2.2         4      2.02                     K.SMQER.G
  2.2         4      2.02                     R.SNICR.S
  2.2         4      2.02                     R.SNLCR.T
Top scoring peptide matches to query 2060
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 31.4     0.011      3.60    4   Q2UHT2_ASPOR K.LSSIPR.D
 31.4     0.011      3.60    5   Q2UT39_ASPOR K.SISLPR.K
 23.2     0.073      3.62    8   Q2TYT6_ASPOR R.AQAILR.I
 23.2     0.073      3.62                     R.QAALLR.S
 17.1       0.3      3.62                     K.AEALLR.V
 15.1      0.48      3.62                     R.QAIALR.N
 12.7      0.83      3.58                     K.DGVLIR.G
 11.3       1.1    -13.13                     R.DRILR.E
 11.3       1.1    -13.13                     R.DRLIR.Q
 11.3       1.1    -13.10                     K.NRIIR.I
Top scoring peptide matches to query 2062
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 25.5     0.044      3.96    8   Q2TYT6_ASPOR R.AQAILR.I
 23.1     0.075      3.96                     K.AEALLR.V
 20.0      0.15      3.94    4   Q2UHT2_ASPOR K.LSSIPR.D
 20.0      0.15      3.94    5   Q2UT39_ASPOR K.SISLPR.K
 18.6      0.21      3.91                     K.DGVLIR.G
 14.2      0.58      3.96                     R.QAALLR.S
 12.4      0.88      3.96                     K.AAEILR.K
 12.4      0.88      3.96                     R.AAELLR.D
  6.9       3.1      3.94                     K.ATPAGKK.L
  6.7       3.3      3.91                     R.QVVLGR.G
Top scoring peptide matches to query 2129
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 21.6     0.031      3.35    9   Q2U7W3_ASPOR R.IQLTPR.A
 20.2     0.043      3.35   10   Q2UGG1_ASPOR R.VAATLPR.F
 16.3      0.11      3.35                     K.AIGTIPR.L
  4.1       1.8      18.8                     K.LQPELK.K
  3.3       2.1      3.35                     K.GTIALPR.W
  3.3       2.1    -12.11                     K.VSRLPR.E
Top scoring peptide matches to query 2234
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 50.4  6.1e-005      2.97    2   TRYP_PIG     R.VATVSLPR.S
 14.5      0.24    -10.36                     R.ITRSIPR.E
  9.3      0.79      3.00                     K.LQKSLPR.Y
  8.6      0.92    -10.36                     R.VAVLERR.D
  7.0       1.3    -10.36                     K.VDRIALR.R
  5.3         2      16.3                     K.VLGTLPDK.G
  3.8       2.8      2.99                     K.LSLGLSPR.S
  0.5         6    -10.34    6   Q2TXG3_ASPOR R.VAALNARK.A
Top scoring peptide matches to query 2236
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 15 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 31.0    0.0049      3.68    2   TRYP_PIG R.VATVSLPR.S
  0.2       5.9     -9.65                 K.VDRIALR.R
  0.2       5.9      17.0                 K.VLGTLPDK.G
Top scoring peptide matches to query 2237
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 50.3  5.7e-005      3.92    2   TRYP_PIG     R.VATVSLPR.S
 14.9       0.2     -9.41                     K.VDRIALR.R
 12.9      0.32     -9.41                     R.ITRSIPR.E
  9.2      0.74      3.95                     K.LQKSLPR.Y
  7.9         1      17.3                     K.VLGTLPDK.G
  7.6       1.1     -9.41                     R.VAVLERR.D
  5.8       1.6      3.92   13   AT222_ASPOR  K.VSGTLPLR.F
  5.6       1.7     -9.39    6   Q2TXG3_ASPOR R.VAALNARK.A
  4.7       2.1      3.92                     R.AVLPVSTR.S
  4.7       2.1     -9.41                     K.VDIRALR.E
Top scoring peptide matches to query 2238
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 15 indicates homology
Score greater than 20 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
  2.1       3.8      4.16    2   TRYP_PIG R.VATVSLPR.S
Top scoring peptide matches to query 2315
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 15 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 15.7      0.28      3.34   14   Q2UA72_ASPOR R.GAVAGMGNGR.G
  1.3       7.6     -3.85                     R.SSGLDAAER.Q
  0.8       8.6      15.8                     R.EACELAGR.R
Top scoring peptide matches to query 2410
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 26.9     0.019    -14.84    6   Q2TXG3_ASPOR R.MVLSVAAYR.E
Top scoring peptide matches to query 2427
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 22 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 18.7      0.19      13.3   12   Q2TZD1_ASPOR K.KTSLDEPGAK.D
  8.1       2.2      13.3   11   UBA4_ASPOR   R.LGNDSQIAVK.R
  1.6       9.7      13.3                     R.SVGNAAVGLQK.G
Top scoring peptide matches to query 2428
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 20.0      0.14      13.7   11   UBA4_ASPOR   R.LGNDSQIAVK.R
 20.0      0.14      13.7   12   Q2TZD1_ASPOR K.KTSLDEPGAK.D
 17.5      0.25      13.7   11   UBA4_ASPOR   R.LGNDSQIAVK.R
  3.7         6      2.98                     K.TAEEAARAVK.I
  3.0       6.9    -14.84                     K.AAAAANKMGIK.V
  0.5        13    -11.64                     K.SWADLVRAK.N
  0.4        13      13.7                     K.AEEDAIAKAK.A
Top scoring peptide matches to query 2431
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 41.9   0.00083      3.73    2   TRYP_PIG K.LSSPATLNSR.V
 14.1       0.5    -10.89                 K.LSSHFVSIR.K
  3.3       6.1     -0.11                 R.LSELEWIR.G
  2.2       7.7     -3.34                 K.MSLELSPIR.V
  1.5       9.1      3.75                 K.KSAPSASQLR.K
  1.5       9.2     -7.02                 K.KSQQSAQLR.V
  1.5       9.2      9.98                 K.QRLAQCLR.N
Top scoring peptide matches to query 2432
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 53.8  5.4e-005      3.92    2   TRYP_PIG K.LSSPATLNSR.V
 14.1      0.51    -10.70                 K.LSSHFVSIR.K
  6.5       2.9      0.08                 R.LSELEWIR.G
  1.3       9.7     -3.16                 R.LDEMVAVIR.D
  0.8        11     -3.15                 K.MSLELSPIR.V
Top scoring peptide matches to query 2451
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 14 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
 14.0      0.34      13.1   15   Q2UQD7_ASPOR R.DVQGLPNVDK.I
  0.5       7.6      9.42                     K.FGFNKQTLK.L
  0.5       7.6      9.40                     R.FNAVFSGTLK.K
  0.1       8.4      9.42                     M.FQILSSFNK.S
  0.0       8.5      8.78                     R.GIRHIMADR.R
  0.0       8.5      2.77                     R.LVREQPADR.S
Top scoring peptide matches to query 2453
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 19 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  8.6       1.2      12.7   15   Q2UQD7_ASPOR R.DVQGLPNVDK.I
  5.9       2.1      15.0                     K.FTLYSPAMR.T
  4.2       3.2      9.03                     M.FQILSSFNK.S
  2.7       4.5      15.0                     K.MPLDFYRK.A
  0.8         7      2.36                     R.SDLHGTTNIK.G
Top scoring peptide matches to query 2543
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein      Peptide
 19.0      0.19      2.33   13   AT222_ASPOR R.EGVAMAQRLEK.G
  2.6       8.2      5.00                    K.GDIFQTVPSQR.L
Top scoring peptide matches to query 2655
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 13 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  1.4       9.3      2.16    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
  0.7        11      12.6                   K.LENAAERGTVGFR.S
  0.2        12    -15.91                   R.DVPLLHQYHAVK.Y
Top scoring peptide matches to query 2656
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 16 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 37.2    0.0025      3.65    1   IGF1_BOVIN R.LEMYCAPLKPAK.S
  1.1        10      4.25                   R.DALQVKVENFEK.I
Top scoring peptide matches to query 2781
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 21 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 30.5    0.0062      0.54    1   IGF1_BOVIN R.APQTGIVDECCFR.S
Top scoring peptide matches to query 2819
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 22.2     0.081      2.12    1   IGF1_BOVIN R.LEMYCAPLKPAKSA.-
Top scoring peptide matches to query 2942
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 58.7  1.6e-005      3.29    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
  9.8       1.2      19.1                   K.ASPMIQAMERMQAAT.-
  1.1       9.3     -2.64                   K.WLQQAQDNKTFSIS.-
Top scoring peptide matches to query 2946
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 21 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 61.3    9e-006      3.96    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
  5.4       3.4      19.7                   K.ASPMIQAMERMQAAT.-
Top scoring peptide matches to query 2954
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 40.6   0.00098      12.6    1   IGF1_BOVIN R.GFYFNKPTGYGSSSR.R
Top scoring peptide matches to query 3004
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 17 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  4.7       4.1      6.88    1   IGF1_BOVIN R.RAPQTGIVDECCFR.S
Top scoring peptide matches to query 3005
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
 28.8     0.016      13.5    1   IGF1_BOVIN R.RAPQTGIVDECCFR.S
Top scoring peptide matches to query 3113
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 14 indicates homology
Score greater than 23 indicates identity
Score    Expect      ppm   Hit  Protein     Peptide
  1.1       9.6      10.4    1   IGF1_BOVIN R.GFYFNKPTGYGSSSRR.A
Top scoring peptide matches to query 3355
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 17 indicates homology
Score greater than 24 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
 19.7      0.14      3.01    2   TRYP_PIG R.LGEHNIDVLEGNEQFINAAK.I
  3.0       6.3      11.0                 R.ASDEPHIHYGLIVSGNQVMK.D
Top scoring peptide matches to query 3428
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 16 indicates homology
Score greater than 22 indicates identity
Score    Expect      ppm   Hit  Protein   Peptide
  3.3         4      14.9    2   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
  1.5       5.9      14.9    2   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
  1.5       5.9      14.9    2   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
  1.5       5.9      14.9    2   TRYP_PIG K.IITHPNFNGNTLDNDIMLIK.L
Top scoring peptide matches to query 4294
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw
Score greater than 19 indicates identity
Score    Expect      ppm   Hit  Protein       Peptide
  3.6         2      0.47                     K.AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR.A
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      4.79    6   Q2TXG3_ASPOR R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E
  2.8       2.5      0.47                     K.AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR.A
  2.8       2.5      0.47                     K.AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR.A
  2.6       2.6      0.47                     K.AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR.A