MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1231_JBEI_1.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:38:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,476

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4447)

Page: Previous 1 2 3 4 5 6 7 8 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2852 400.4308 1597.6941 1597.7076 -8.42 1 3 0.89 +1Score > 21 indicates identity
Score > 15 indicates homology		 KMDESANAMSLASAR + Deamidated (NQ); Oxidation (M)
3910 547.5593 3825.8642 3825.8308 8.71 1 3 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 LHDGLDLEMFAHQVESAPAIDDFRTIQDAWIVR + 2 Deamidated (NQ); Oxidation (M)
4138 771.2328 5391.5787 5391.5997 -3.91 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MYSQIPNVEVQPFRLKPHHLNISTLLSLMCVGNGDQMPLYMSQVIR + 6 Deamidated (NQ); 2 Oxidation (M)
2180 395.2363 788.4580 788.4545 4.56 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 IFREPK
4436 958.0824 7656.6010 7656.5736 3.58 1 3 1 +1Score > 15 indicates identity QAMLHHNGDVDQMIFQSFMIMHCASIYLHFPKSYLLAFLPVTSHIFCSRPPTFTSSSANPQIHTAK + 6 Deamidated (NQ); 3 Oxidation (M)
3633 888.8100 2663.4082 2663.4298 -8.11 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GFWAANVLALCSSWIGVALLAIFGK
4289 801.9600 5606.6691 5606.6731 -0.72 0 3 0.9 +1Score > 20 indicates identity
Score > 15 indicates homology		 AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + Deamidated (NQ); 2 Oxidation (M)
2421 517.2956 1032.5766 1032.5716 4.88 1 3 0.66 +1Score > 22 indicates identity
Score > 13 indicates homology		 ALNVGKEFR
4049 697.1807 4177.0405 4176.9626 18.7 1 3 0.71 +1Score > 22 indicates identity
Score > 14 indicates homology		 LFYVADIEGSGPSLNGQAHLSLNDNQFFLLMAYDKDR + 3 Deamidated (NQ); Oxidation (M)
4349 1132.1785 5655.8561 5655.8017 9.62 1 3 1.9 +1Score > 18 indicates identity VILEAMESLELPLEDARHEYHVQTIFMQPAQIEGDNLPPEVGNAIGALWR + Deamidated (NQ); Oxidation (M)
3991 981.7155 3922.8329 3922.8739 -10.4 1 3 0.79 +1Score > 22 indicates identity
Score > 14 indicates homology		 LFAIFNFVFVAPACINQMQPFFLHNRDIFETR + 5 Deamidated (NQ); Oxidation (M)
2833 796.8716 1591.7286 1591.7492 -12.9 1 3 0.63 +1Score > 23 indicates identity
Score > 13 indicates homology		 RAGGPPSAGFGSGFGDR
2030 647.3087 646.3014 646.3108 -14.6 0 3 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 QPMVR + Deamidated (NQ); Oxidation (M)
3331 364.5297 2181.1345 2181.0993 16.1 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QFSLVISDLYHYINPKNK + 3 Deamidated (NQ)
4041 814.1622 4065.7746 4065.8030 -6.98 1 3 2.1 +1Score > 18 indicates identity IVRSEMENGMAQPNATIEEPLTTDSAGPNMDYSYYR + Oxidation (M)
3035 433.1789 1728.6865 1728.6904 -2.24 1 3 0.58 +1Score > 13 indicates identity MMNSSSNDNGNSQRR + 2 Oxidation (M)
3839 737.9630 3684.7786 3684.7240 14.8 1 3 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 IFLEDEETDGIIMIGEIGGSAEEDAAEFLKANNK + Deamidated (NQ); Oxidation (M)
2918 550.9255 1649.7547 1649.7757 -12.8 1 3 0.96 +1Score > 23 indicates identity
Score > 15 indicates homology		 NESSHSTKAPADHLR + Deamidated (NQ)
4056 862.9893 4309.9101 4309.8298 18.6 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GMGPNQQLPPNFQGIPMGAMQGPVPNGMGYPQGMAQVQFGR + 10 Deamidated (NQ); Oxidation (M)
4002 792.5699 3957.8131 3957.7349 19.8 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 RPRSSLSNPAGQNVPINGMSHIDEDEDLSMHMSMR + 2 Deamidated (NQ); 3 Oxidation (M)
2678 480.2913 1437.8521 1437.8303 15.1 1 2 0.79 +1Score > 14 indicates identity KQLGAVDISAPALR
3205 649.9402 1946.7988 1946.8325 -17.3 0 2 1.4 +1Score > 17 indicates identity VGVCAMAGVNMGPFSDYR + Deamidated (NQ); Oxidation (M)
3297 352.5177 2109.0625 2109.0563 2.97 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 NGNTELHVAATQGLVDASRR + Deamidated (NQ)
4167 909.4380 5450.5843 5450.6306 -8.48 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 EQPPAYSYSPYLQSLPAMNGFVAPYHPTSSPRVAPAQYSTVNATPQSNIR + Deamidated (NQ)
2235 421.7598 841.5050 841.4909 16.8 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 GVVIPQTK + Deamidated (NQ)
4077 901.8784 4504.3556 4504.3774 -4.84 1 2 1.3 +1Score > 16 indicates identity ITTLSTQVAPPTHDLTRQIPTIQLLQAALIIEMLQFGQER + 4 Deamidated (NQ); Oxidation (M)
3846 615.1387 3684.7885 3684.7981 -2.59 1 2 0.65 +1Score > 23 indicates identity
Score > 13 indicates homology		 NPTEEGAFPLDQIPAERAGTPEDIMGPLLYLASR + Deamidated (NQ); Oxidation (M)
2709 490.2462 1467.7168 1467.7279 -7.57 1 2 0.74 +1Score > 24 indicates identity
Score > 14 indicates homology		 TLYGMSLENKAPK + Deamidated (NQ); Oxidation (M)
3504 794.3769 2380.1089 2380.0675 17.4 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 EMDLSLPQELDFRMEADNAR + Deamidated (NQ)
2216 412.2446 822.4746 822.4712 4.22 0 2 1.9 +1Score > 18 indicates identity VIHQLGR + Deamidated (NQ)
2214 412.2445 822.4744 822.4712 3.98 0 2 1.9 +1Score > 18 indicates identity VLHLADR
4370 837.3962 5854.7225 5854.6984 4.10 1 2 2.8 +1Score > 19 indicates identity IVVAMSNGEGYSYSPSMFTWQRISEPWWAVGSQYWNTTEAPVGNLQTADAQK + Deamidated (NQ); Oxidation (M)
3858 615.1403 3684.7981 3684.8206 -6.10 1 2 0.75 +1Score > 23 indicates identity
Score > 13 indicates homology		 GRQGYQYNVSPVDVVVTHITDMRPPSDPTLSVR + 2 Deamidated (NQ)
2376 320.5332 958.5778 958.5634 15.0 0 2 2.5 +1Score > 19 indicates identity MVLGIAVTR
3092 900.4261 1798.8376 1798.8043 18.5 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 GDDMNARVEYLVDASK + Deamidated (NQ); Oxidation (M)
2938 555.9227 1664.7463 1664.7689 -13.6 1 2 0.84 +1Score > 22 indicates identity
Score > 14 indicates homology		 VMENHQNGKDTHVR + Deamidated (NQ)
3361 445.0335 2220.1311 2220.0910 18.1 1 2 0.76 +1Score > 23 indicates identity
Score > 13 indicates homology		 SDLEANVEALIQETDFLRR + 2 Deamidated (NQ)
2754 507.9259 1520.7559 1520.7259 19.7 0 2 0.83 +1Score > 24 indicates identity
Score > 14 indicates homology		 SNVSYVEIPHYGR + Deamidated (NQ)
3595 523.0370 2610.1486 2610.1438 1.84 1 2 0.68 +1Score > 20 indicates identity
Score > 13 indicates homology		 NESSRTNTAPGEMIQGMNGASWVR + 2 Deamidated (NQ); Oxidation (M)
3371 742.3426 2224.0060 2224.0187 -5.73 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 RECETCIMAYTHVGTQLR
4141 899.7689 5392.5697 5392.4830 16.1 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 AWHADPARMALLENTASPDQINSADLDAIYFTGGHAVMYDFPDSEGLQR + Oxidation (M)
4269 934.6008 5601.5611 5601.5023 10.5 0 2 3 +1Score > 19 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 12 Deamidated (NQ); Oxidation (M)
3239 663.6157 1987.8253 1987.8647 -19.8 0 2 1.7 +1Score > 17 indicates identity ESPPAYNTTSTDINTGYR + 2 Deamidated (NQ)
3934 549.9871 3842.8588 3842.8520 1.76 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 LDEVDDEADGQFIEMNLGLGVLEEKRPADGVAPSAK + Oxidation (M)
2352 469.7582 937.5018 937.4981 3.99 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 VDLHNALR + Deamidated (NQ)
3744 805.6207 3218.4537 3218.5151 -19.1 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 LIDLLSGSFMPTLSSNKQMIEEFHQYR + 3 Deamidated (NQ); 2 Oxidation (M)
3941 641.4847 3842.8645 3842.8036 15.8 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 FSGKAMLPIMMLGWGSVTLLQCAAFNFAGMLVCR + 2 Deamidated (NQ); 4 Oxidation (M)
3061 589.6580 1765.9522 1765.9727 -11.6 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 DFVGQHVKAADKPIIK + Deamidated (NQ)
4299 935.9490 5609.6503 5609.6251 4.50 0 2 3.1 +1Score > 19 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 4 Deamidated (NQ); 2 Oxidation (M)
3449 1162.0389 2322.0632 2322.0975 -14.8 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 TSVKHEDPETDEDVPLALNGR + Deamidated (NQ)
2592 666.3652 1330.7158 1330.7132 1.96 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LVETEKLGWQK + Deamidated (NQ)
3851 737.9658 3684.7926 3684.7700 6.15 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 RLNFGLMLMFASAAANGYDGALMNGLLTLPMFAK + 2 Deamidated (NQ); 4 Oxidation (M)
3936 641.4838 3842.8591 3842.7952 16.7 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 DLLDHNELNNCLALHAVANVGGREMGEALSTDVHR + 3 Deamidated (NQ)
3958 644.1495 3858.8533 3858.8292 6.27 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 RPTQPKPKSSSVPPVPSFEEDMDLNIPDASSGSAMK + Deamidated (NQ); 2 Oxidation (M)
3980 651.1550 3900.8863 3900.9356 -12.6 1 2 0.91 +1Score > 23 indicates identity
Score > 14 indicates homology		 LSFNADPSHPILQVEEDISQWGAMSLNSLFGLTKR + Deamidated (NQ)
3002 569.9333 1706.7781 1706.8120 -19.9 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 FLQPMPQELRMER + Deamidated (NQ); 2 Oxidation (M)
2611 457.5775 1369.7107 1369.6838 19.6 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VEKQDGEVDPVR
3469 589.7766 2355.0773 2355.0542 9.79 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 YYQIRDDYQNLVSDEYAAK + 2 Deamidated (NQ)
4174 787.0994 5502.6449 5502.6721 -4.94 1 2 2.9 +1Score > 19 indicates identity GRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTSDDFASQMDGR + 2 Oxidation (M)
3737 770.3506 3077.3733 3077.4274 -17.6 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MAIALSTVDGNLYSAGDDEVEFSIQSISK + 2 Deamidated (NQ); Oxidation (M)
2442 534.2799 1066.5452 1066.5659 -19.3 0 2 0.94 +1Score > 22 indicates identity
Score > 14 indicates homology		 ENVVLHDLK + Deamidated (NQ)
2567 432.2221 1293.6445 1293.6241 15.7 0 2 0.89 +1Score > 24 indicates identity
Score > 14 indicates homology		 SSFLAPDFDPAK
4031 805.9641 4024.7841 4024.8563 -17.9 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 IVETAPDSNGDEHTIVGSYVQKSQTGWNLQYTSDER + Deamidated (NQ)
2364 954.5921 953.5848 953.6022 -18.2 0 2 1.6 +1Score > 16 indicates identity LIVVNQLR
3376 742.3443 2224.0111 2224.0405 -13.2 1 2 0.81 +1Score > 23 indicates identity
Score > 13 indicates homology		 GTGPQLFRASLDMDWNMLR + Deamidated (NQ); Oxidation (M)
2953 417.9519 1667.7785 1667.7679 6.38 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 WLQQAQDNKTFSIS + 3 Deamidated (NQ)
2821 527.6096 1579.8070 1579.8206 -8.61 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IISLVGDNHDLQVR + 2 Deamidated (NQ)
2977 421.9522 1683.7797 1683.7895 -5.81 1 2 0.9 +1Score > 23 indicates identity
Score > 14 indicates homology		 MQAMPPPTSRMPAPR + Deamidated (NQ); Oxidation (M)
4434 1092.3840 7639.6371 7639.5675 9.10 0 2 1.4 +1Score > 16 indicates identity ETINSFGVNSIPTSHYVPANWGFTLPTAESLDTIYANLNDGTSLSQENSLSPESLQLTPDMQQQPGELLR + 7 Deamidated (NQ)
2768 513.2518 1536.7336 1536.7276 3.91 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 ETLERQLVMMNR + 2 Deamidated (NQ); Oxidation (M)
2893 545.6024 1633.7854 1633.8094 -14.7 0 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 MSSLQEVIQQVNSR + Oxidation (M)
3503 794.3690 2380.0852 2380.0814 1.58 0 2 0.75 +1Score > 22 indicates identity
Score > 13 indicates homology		 MESFNSTTALPQMASYTDLIK + Deamidated (NQ); 2 Oxidation (M)
4135 764.6604 5345.5719 5345.4764 17.9 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TGEEINIPFQDMLPMVHPNDLAIGGWDISSMNIADAMDRAQVLEPSLK + 3 Deamidated (NQ); 4 Oxidation (M)
2443 534.2807 1066.5468 1066.5546 -7.29 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DLDITISYK
4448 1112.3899 7779.6784 7779.8024 -15.9 0 2 1.6 +1Score > 16 indicates identity ALSSGSADVTGIGSNLGMGKPNSSTILFDGANFIALALLASTPQLVFSALYLLCNGLFTCMLAVAEYNDFATQR + 3 Deamidated (NQ); 2 Oxidation (M)
4160 909.2730 5449.5943 5449.6122 -3.28 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DPDSRPLELAIASEVLDHLVAGHETSGITFTYMMWELSQHPELQAELR + 2 Deamidated (NQ); Oxidation (M)
4411 943.8689 6600.0314 6600.1557 -18.8 0 2 2.2 +1Score > 18 indicates identity SPELNADALAATAGLMDGANVVLDASGAEPCINCGIHALAHGGTFVQVGLGRPNLSLPVGQICDK + 5 Deamidated (NQ); Oxidation (M)
2150 379.7307 757.4468 757.4446 2.95 1 2 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 DNKLLR
3789 706.5456 3527.6916 3527.7507 -16.8 1 2 0.94 +1Score > 23 indicates identity
Score > 14 indicates homology		 LFNDLKIPYLVAAADSGNMGGNLSHEFHVPSSK
3724 741.3414 2961.3365 2961.3080 9.63 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 EVIGNEEMPENQDEASAAMDRVLENR + Oxidation (M)
4157 779.3779 5448.5944 5448.5622 5.90 1 2 0.85 +1Score > 21 indicates identity
Score > 13 indicates homology		 QMVPNGGTPPHMDVKNMEVLEAQVLHPEASQGSAPAQYIQIEGVLDMSQK + 2 Deamidated (NQ); 3 Oxidation (M)
3859 738.1597 3685.7621 3685.7644 -0.62 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 TTIIITHDMSHIMDKDFVYVLDQGSVVQSGYR + 2 Deamidated (NQ); Oxidation (M)
4072 743.8937 4457.3185 4457.2503 15.3 1 1 2.5 +1Score > 18 indicates identity SVPLPGLPTGPVQPEASQEPEAHQVAPSPPEQPRSPTPTPPVR + 2 Deamidated (NQ)
4279 934.8257 5602.9105 5602.8458 11.6 0 1 1.3 +1Score > 15 indicates identity DLSAGETIVEASIQAFGPNIDILVNNAGVEVVKPLSDLTVEDYNLVYDLNVR + 2 Deamidated (NQ)
3853 737.9659 3684.7931 3684.7538 10.7 1 1 0.76 +1Score > 23 indicates identity
Score > 13 indicates homology		 AENEEQIIEALRCTSMDPYLADQVLDYLIAGK + Deamidated (NQ); Oxidation (M)
2197 403.1768 804.3390 804.3250 17.5 0 1 3.2 +1Score > 19 indicates identity QEQQDR + 2 Deamidated (NQ)
4065 874.5927 4367.9271 4367.9876 -13.9 1 1 3.2 +1Score > 19 indicates identity QLLHLDQPHTSNPALNADLGYNGFLTSNDTGAHSMPTRSR + 6 Deamidated (NQ); Oxidation (M)
2159 384.2041 766.3936 766.3861 9.84 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NGTFLSK + Deamidated (NQ)
3099 904.4827 1806.9508 1806.9437 3.96 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 EQQMTLLQGIKLYPK + 2 Deamidated (NQ); Oxidation (M)
4261 799.5643 5589.8992 5589.8853 2.48 1 1 1.3 +1Score > 15 indicates identity LIPDLITTASVETVQAFLLFGVYTMPIDTSGLAYTYLGLAIKMAIQNGMHR + Deamidated (NQ); 2 Oxidation (M)
2587 439.5828 1315.7266 1315.7282 -1.22 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 IINAVGRDALMK + Oxidation (M)
3762 1116.2721 3345.7945 3345.7429 15.4 1 1 2.5 +1Score > 18 indicates identity QNATSVAEAIAGAVLEQLQFAPPNTSANHKLR
4282 801.4241 5602.9178 5602.8458 12.8 0 1 1.2 +1Score > 15 indicates identity DLSAGETIVEASIQAFGPNIDILVNNAGVEVVKPLSDLTVEDYNLVYDLNVR + 2 Deamidated (NQ)
3924 641.3191 3841.8709 3841.8298 10.7 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LYVTFGSHASEDFYGLGAQASFASMKNQTIPIFSR + 2 Deamidated (NQ)
4020 999.7086 3994.8053 3994.8286 -5.82 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QGSQQPEMNTTHPPERPASQAARPASRLGSMQPYNR + 4 Deamidated (NQ); Oxidation (M)
2546 627.3523 1252.6900 1252.6816 6.77 0 1 3.2 +1Score > 19 indicates identity FQPAVPPVLER + Deamidated (NQ)
2507 395.8684 1184.5834 1184.5673 13.6 0 1 0.83 +1Score > 23 indicates identity
Score > 13 indicates homology		 SNLPPANLNSR + 3 Deamidated (NQ)
2872 405.9508 1619.7741 1619.7825 -5.16 0 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 MSSLQEVIQQVNSR + 2 Deamidated (NQ)
4457 1114.8209 7796.6954 7796.5836 14.3 1 1 1.9 +1Score > 17 indicates identity VLFDGMHGVTGPYGVDIFVNELGLPSSSTMNCVPSPDFNGGHPDPNLVYAHELVEAVDKNGIHFGAASDGDGDR + Deamidated (NQ); Oxidation (M)
4251 798.7034 5583.8729 5583.8314 7.42 1 1 2.1 +1Score > 17 indicates identity TDGELDLQRIVSIFAQAGLIEFQNVHSWDAVSANVPGFSVHAAISLVPHPTK + 3 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/