MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1231_JBEI_1.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:38:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,476

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4447)

Page: 1 2 3 4 5 6 … 45 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1828 515.3571 514.3498 514.3479 3.83 0 21 0.069 +1Score > 23 indicates identity
Score > 22 indicates homology		 AALLK
2309 450.7682 899.5218 899.5076 15.8 0 19 0.11 +1Score > 22 indicates identity EAALEIVR
2427 349.1936 1044.5590 1044.5451 13.3 1 19 0.11 +1Score > 24 indicates identity
Score > 22 indicates homology		 KTSLDEPGAK
2243 422.7438 843.4730 843.4715 1.84 1 18 0.13 +1Score > 25 indicates identity
Score > 22 indicates homology		 KWLQNR
3135 615.9791 1844.9155 1844.9169 -0.80 1 16 0.067 +1Score > 25 indicates identity
Score > 17 indicates homology		 LLHWAANTTRTDGYGIG
2408 501.7787 1001.5428 1001.5328 10.1 0 16 0.077 +1Score > 24 indicates identity
Score > 17 indicates homology		 QEVIMINR
2139 743.4438 742.4365 742.4337 3.76 0 15 0.22 +1Score > 24 indicates identity
Score > 21 indicates homology		 TGLSIPR
2107 357.6832 713.3518 713.3385 18.8 0 15 0.11 +1Score > 18 indicates identity FGFDTK
2613 458.2494 1371.7264 1371.7187 5.60 0 14 0.061 +1Score > 24 indicates identity
Score > 14 indicates homology		 FAGLFSPPPGSPAK
2513 602.3039 1202.5932 1202.6118 -15.4 0 14 0.39 +1Score > 25 indicates identity
Score > 22 indicates homology		 CLEIVWLDR
2554 638.3428 1274.6710 1274.6653 4.55 1 14 0.27 +1Score > 23 indicates identity
Score > 20 indicates homology		 RDDLLLDMIR + Oxidation (M)
1827 515.3315 514.3242 514.3227 2.92 0 13 0.21 +1Score > 26 indicates identity
Score > 19 indicates homology		 LGAVR
2153 381.7122 761.4098 761.4184 -11.2 0 13 0.49 +1Score > 23 indicates identity HIHIDK
3989 783.9661 3914.7941 3914.7713 5.82 1 13 0.39 +1Score > 21 indicates identity EQMEELFQAKLQEQDVDATPEAFQAAMDILESAR + 2 Deamidated (NQ); 2 Oxidation (M)
2492 575.7897 1149.5648 1149.5567 7.07 1 12 0.12 +1Score > 24 indicates identity
Score > 16 indicates homology		 DGWVKFQDR
2512 600.8554 1199.6962 1199.7125 -13.6 1 12 0.32 +1Score > 20 indicates identity AVVEDTKVVLK
2721 742.8443 1483.6740 1483.6918 -12.0 1 12 0.15 +1Score > 22 indicates identity
Score > 16 indicates homology		 GSCYKFSFYGIR
2607 455.2371 1362.6895 1362.7031 -9.97 0 12 0.92 +1Score > 24 indicates identity VYSLNDDLKPAK + Deamidated (NQ)
2520 405.2242 1212.6508 1212.6714 -17.0 0 12 0.15 +1Score > 22 indicates identity
Score > 16 indicates homology		 VLIEPSVNSVR + Deamidated (NQ)
2039 327.7014 653.3882 653.3860 3.37 0 12 0.2 +1Score > 17 indicates identity ATPIPR
2747 504.2658 1509.7756 1509.7464 19.4 0 12 0.21 +1Score > 23 indicates identity
Score > 17 indicates homology		 EIFELSQGGVEFR
3770 684.7242 3418.5846 3418.6405 -16.3 1 11 0.84 +1Score > 23 indicates identity TGWRPRAPEDFGDGGAFPEILVAQYPLDMGR + Deamidated (NQ)
2276 435.7756 869.5366 869.5334 3.72 0 11 0.3 +1Score > 19 indicates identity VALNILAR + Deamidated (NQ)
2556 426.8899 1277.6479 1277.6364 9.02 1 11 1 +1Score > 24 indicates identity
Score > 24 indicates homology		 RIYQLQNANR + 3 Deamidated (NQ)
2138 743.4438 742.4365 742.4337 3.76 0 11 0.7 +1Score > 24 indicates identity
Score > 22 indicates homology		 TGLSIPR
2570 433.2437 1296.7093 1296.6898 15.0 1 11 0.49 +1Score > 20 indicates identity ERTGRPASQPAK
2087 347.7115 693.4084 693.4061 3.35 0 10 0.19 +1Score > 16 indicates identity SFVITK
2245 423.2286 844.4426 844.4337 10.6 1 10 0.64 +1Score > 25 indicates identity
Score > 21 indicates homology		 SPAQRMR
2576 650.8208 1299.6270 1299.6129 10.9 1 10 0.28 +1Score > 22 indicates identity
Score > 17 indicates homology		 YLQTMANSKSR + 2 Deamidated (NQ)
4288 801.9586 5606.6593 5606.6502 1.62 1 10 0.48 +1Score > 20 indicates identity
Score > 20 indicates homology		 ESLGYYTNGSHLAGQGLQQAQWTQELWDAIGLSNASVKSYSANLTLPNEHR + 4 Deamidated (NQ)
2140 372.7175 743.4204 743.4177 3.64 0 10 0.33 +1Score > 24 indicates identity
Score > 18 indicates homology		 LVEVQR + Deamidated (NQ)
2892 817.8997 1633.7848 1633.8134 -17.5 0 10 0.17 +1Score > 24 indicates identity
Score > 14 indicates homology		 EIVSPSATVQMFPGR + Oxidation (M)
2939 555.9229 1664.7469 1664.7498 -1.74 1 10 0.37 +1Score > 22 indicates identity
Score > 18 indicates homology		 MQAEMLASDDSPARK + Oxidation (M)
4394 781.2565 6241.9938 6241.8904 16.6 1 9 0.46 +1Score > 19 indicates identity AQAAQKAQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 7 Deamidated (NQ); 4 Oxidation (M)
4341 941.4339 5642.5597 5642.5990 -6.95 0 9 0.47 +1Score > 18 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 5 Deamidated (NQ); 4 Oxidation (M)
2514 401.8718 1202.5936 1202.5965 -2.44 0 9 0.95 +1Score > 25 indicates identity
Score > 21 indicates homology		 MINGTPGIDIR + Deamidated (NQ); Oxidation (M)
1889 571.3583 570.3510 570.3489 3.66 0 9 0.24 +1Score > 15 indicates identity SVLPR
3951 643.8153 3856.8481 3856.8395 2.24 1 9 1 +1Score > 22 indicates identity
Score > 21 indicates homology		 GKPLGALPMTEWIGRAMQAGMNEMVGLYLQEVTSK + 3 Deamidated (NQ); 3 Oxidation (M)
2277 870.5443 869.5370 869.5447 -8.80 1 9 0.44 +1Score > 18 indicates identity VLLVRDR
2566 431.2197 1290.6373 1290.6172 15.5 1 9 0.16 +1Score > 24 indicates identity
Score > 13 indicates homology		 AMAARGIDMAQR + Deamidated (NQ)
2612 458.2483 1371.7231 1371.7187 3.20 0 9 1 +1Score > 24 indicates identity
Score > 21 indicates homology		 FAGLFSPPPGSPAK
4036 1008.4733 4029.8641 4029.8419 5.51 1 8 1 +1Score > 22 indicates identity
Score > 21 indicates homology		 IREANETPSLSTPIPQPSPSQDGIEGTTAEQSNAMSMR + 3 Deamidated (NQ)
2191 400.2566 798.4986 798.4963 2.91 0 8 0.72 +1Score > 19 indicates identity IVIELGR
4357 815.0992 5698.6435 5698.5457 17.2 0 8 0.68 +1Score > 19 indicates identity VEPFMFEGQLQTSNPMTVAAPQASFNPPSGHPPEPGLHSYSHLYAGSGPNQVR + 7 Deamidated (NQ); 2 Oxidation (M)
3942 641.4849 3842.8657 3842.8820 -4.23 0 8 1 +1Score > 23 indicates identity
Score > 20 indicates homology		 ELLMAVLSMVMLSIFHGENSNAQAFLVDAEYLIR + 3 Deamidated (NQ); Oxidation (M)
4298 802.2470 5608.6781 5608.6411 6.59 0 8 0.77 +1Score > 19 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 3 Deamidated (NQ); 2 Oxidation (M)
2357 473.2633 944.5120 944.5291 -18.0 0 8 0.63 +1Score > 25 indicates identity
Score > 18 indicates homology		 NLTLSELR
4035 1008.2238 4028.8661 4028.8579 2.04 1 8 0.27 +1Score > 22 indicates identity
Score > 14 indicates homology		 IREANETPSLSTPIPQPSPSQDGIEGTTAEQSNAMSMR + 2 Deamidated (NQ)
4169 909.4403 5450.5981 5450.5302 12.5 1 8 0.59 +1Score > 21 indicates identity
Score > 18 indicates homology		 QMVPNGGTPPHMDVKNMEVLEAQVLHPEASQGSAPAQYIQIEGVLDMSQK + 4 Deamidated (NQ); 3 Oxidation (M)
4013 795.5766 3972.8466 3972.7847 15.6 0 7 0.64 +1Score > 22 indicates identity
Score > 18 indicates homology		 MQSQQPIPQPQPSPPEGTHNASQFELEQPSLPATDR + 6 Deamidated (NQ)
3800 598.6267 3585.7165 3585.6789 10.5 0 7 1 +1Score > 23 indicates identity
Score > 20 indicates homology		 AMVCHLINLLAEMNQVGGGYDNQPADPTSLLNK + 3 Deamidated (NQ)
4037 806.9820 4029.8736 4029.8419 7.88 1 7 1 +1Score > 22 indicates identity
Score > 20 indicates homology		 IREANETPSLSTPIPQPSPSQDGIEGTTAEQSNAMSMR + 3 Deamidated (NQ)
4338 806.9547 5641.6320 5641.7212 -15.8 1 7 0.84 +1Score > 19 indicates identity SQGSTQLLPNRNVLVNWGSEGALTEFRPDGTPIFHTYMDSGFLGLGVENYR + 2 Deamidated (NQ)
4114 961.6653 4803.2901 4803.2899 0.039 0 7 1 +1Score > 21 indicates identity
Score > 20 indicates homology		 QSQNATNLVTWLHNALQAQNPAPDSDEAVTQAALQQVYHASLQK + 5 Deamidated (NQ)
4249 798.5233 5582.6122 5582.5553 10.2 0 7 0.91 +1Score > 19 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 9 Deamidated (NQ)
3117 608.9683 1823.8831 1823.8789 2.29 0 7 1 +1Score > 24 indicates identity
Score > 20 indicates homology		 VDALDSAIQAYTGGDVTK + Deamidated (NQ)
2455 543.8141 1085.6136 1085.6081 5.13 0 7 0.49 +1Score > 22 indicates identity
Score > 17 indicates homology		 SVGELDVVLR
3474 472.8236 2359.0816 2359.0672 6.13 0 7 0.36 +1Score > 23 indicates identity
Score > 15 indicates homology		 TGSYVLQASIAVQDGGNQEMMK + Deamidated (NQ); 2 Oxidation (M)
1986 316.1756 630.3366 630.3337 4.71 0 7 0.84 +1Score > 26 indicates identity
Score > 19 indicates homology		 IDDIR
2149 379.7303 757.4460 757.4446 1.90 1 7 1 +1Score > 24 indicates identity
Score > 19 indicates homology		 DNKLLR
2130 365.7169 729.4192 729.4133 8.13 1 7 0.45 +1Score > 23 indicates identity
Score > 16 indicates homology		 EGRQIK
3453 775.3652 2323.0738 2323.0671 2.86 0 7 0.41 +1Score > 23 indicates identity
Score > 16 indicates homology		 IALLQSSNVQDNDNLEMMVR + 2 Deamidated (NQ); 2 Oxidation (M)
3733 761.1232 3040.4637 3040.4310 10.7 1 7 0.55 +1Score > 24 indicates identity
Score > 17 indicates homology		 AVTAVVDSPNHKALCWADYTSSYMLPK + Deamidated (NQ); Oxidation (M)
1992 317.1926 632.3706 632.3679 4.27 0 7 0.61 +1Score > 17 indicates identity MLTIR
4274 934.6594 5601.9127 5601.8618 9.10 0 7 0.33 +1Score > 14 indicates identity DLSAGETIVEASIQAFGPNIDILVNNAGVEVVKPLSDLTVEDYNLVYDLNVR + Deamidated (NQ)
3660 539.2675 2691.3011 2691.2772 8.89 1 7 1 +1Score > 24 indicates identity
Score > 19 indicates homology		 TEFADTMTKVVMSVYGLSHTVNTK + Deamidated (NQ); 2 Oxidation (M)
4009 993.9670 3971.8389 3971.8007 9.62 0 7 0.33 +1Score > 22 indicates identity
Score > 14 indicates homology		 MQSQQPIPQPQPSPPEGTHNASQFELEQPSLPATDR + 5 Deamidated (NQ)
3181 643.2911 1926.8515 1926.8564 -2.55 1 7 1 +1Score > 21 indicates identity
Score > 19 indicates homology		 REQLDAMDMDLGFGSSR
3837 615.1368 3684.7771 3684.7227 14.8 1 6 0.42 +1Score > 23 indicates identity
Score > 15 indicates homology		 LTHTYPQCIISPSSSHTRSTPNSYKPDHESTR + Deamidated (NQ)
4453 1114.6742 7795.6685 7795.6255 5.52 1 6 0.58 +1Score > 17 indicates identity MKPEPGVSEAGDQPVLAYPPHAPLGQVPNMHPDMRYQPQTHPNPALPLLQNPYMPGGYTSAPPMPNGGAPQGR + 6 Deamidated (NQ); 2 Oxidation (M)
3143 617.3110 1848.9112 1848.9118 -0.35 1 6 1 +1Score > 24 indicates identity
Score > 19 indicates homology		 GQALNGWQSARQELYK + Deamidated (NQ)
2496 579.8055 1157.5964 1157.5975 -0.90 1 6 0.38 +1Score > 24 indicates identity
Score > 15 indicates homology		 MAQERAAPIR + Oxidation (M)
4400 908.5747 6352.9720 6352.8479 19.5 0 6 0.89 +1Score > 18 indicates identity FHYISADLTNAAQCEQIIEEVTEWNYGLPPDVVWCCAGYCNPGFFVDTPVQTLR + 3 Deamidated (NQ)
3922 549.8449 3841.8634 3841.9092 -11.9 1 6 1 +1Score > 23 indicates identity
Score > 19 indicates homology		 IVTMLSNNPVWAAEGPELEWRAELQQMLMLNLK + 2 Deamidated (NQ); Oxidation (M)
3207 976.4668 1950.9190 1950.8815 19.2 1 6 1 +1Score > 24 indicates identity
Score > 19 indicates homology		 VMTAATYRIDTQNMYR + 2 Deamidated (NQ); Oxidation (M)
2981 422.4812 1685.8957 1685.8723 13.9 0 6 0.43 +1Score > 23 indicates identity
Score > 15 indicates homology		 IGTLDALVQQADELAK + 2 Deamidated (NQ)
2278 436.2732 870.5318 870.5287 3.63 1 6 1 +1Score > 21 indicates identity
Score > 19 indicates homology		 QLVVEKR
4331 806.6662 5639.6125 5639.6469 -6.11 0 6 1.1 +1Score > 19 indicates identity AQMAISQAGQANSQMQQQLTQQSPAMPMLNRPMAPGQMSPAQVTAQVRPPSR + 2 Deamidated (NQ); 4 Oxidation (M)
4115 964.2710 4816.3186 4816.3560 -7.76 1 6 1 +1Score > 22 indicates identity
Score > 19 indicates homology		 DDAVQGLLALGSTAGSNDVRSESTNLSLPSPNIALSSLMNSRPSEVK + 3 Deamidated (NQ); Oxidation (M)
1965 310.1848 618.3550 618.3523 4.43 0 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology		 MVTLR
4130 891.7684 5344.5667 5344.5317 6.56 1 6 1 +1Score > 21 indicates identity
Score > 19 indicates homology		 EANSPFAIRGGGHMPIANAANINSSGVLLSSFGLTQLSLSDDQSTVNVGPGNR + 7 Deamidated (NQ)
4369 837.3962 5854.7225 5854.7108 2.00 1 6 1.2 -1Score > 19 indicates identity ESIYASPYAPELEGQSQNFGILDVEMALQWVYDNIRGGHSSGAVHVSNSQILR + 7 Deamidated (NQ); Oxidation (M)
4396 908.2856 6350.9483 6350.9334 2.35 1 6 0.88 +1Score > 18 indicates identity HTTEVLTEKAMGFLEDALSGERPFFMAVSPIAPHSNMNGTYGAGSGPLWMDEPIPEDR + 3 Oxidation (M)
3114 608.9667 1823.8783 1823.9054 -14.9 0 6 1 +1Score > 23 indicates identity
Score > 18 indicates homology		 VTNSPSNLVWYSISTR + Deamidated (NQ)
3110 608.6346 1822.8820 1822.8818 0.092 1 6 0.38 +1Score > 24 indicates identity
Score > 14 indicates homology		 KPRNFIATVACETCR + Deamidated (NQ)
2993 850.3826 1698.7506 1698.7606 -5.88 1 6 1 +1Score > 21 indicates identity
Score > 18 indicates homology		 APVYCPYQRDGAMR + Oxidation (M)
3768 684.5189 3417.5581 3417.6068 -14.2 1 6 1 +1Score > 23 indicates identity
Score > 18 indicates homology		 MVEDQIEDPATGSAACALTSYLALQKYSETR
4397 908.4282 6351.9465 6351.8639 13.0 0 6 0.85 +1Score > 18 indicates identity FHYISADLTNAAQCEQIIEEVTEWNYGLPPDVVWCCAGYCNPGFFVDTPVQTLR + 2 Deamidated (NQ)
4129 891.7682 5344.5655 5344.4841 15.2 1 6 0.33 +1Score > 21 indicates identity
Score > 13 indicates homology		 GINDNQDLPEEYLTSIYDEIAGNEIVLDTEREHAANVGMPTGTPGGLASR + 3 Deamidated (NQ)
4026 802.9709 4009.8181 4009.8667 -12.1 1 6 0.61 +1Score > 21 indicates identity
Score > 16 indicates homology		 YDEIEQQVSAFLTTAGFQAKNIAFVPCSGISGDNVTK + 5 Deamidated (NQ)
3090 898.4156 1794.8166 1794.8492 -18.1 1 6 0.59 +1Score > 23 indicates identity
Score > 16 indicates homology		 VRQTLQDLMMTADEK + Deamidated (NQ); Oxidation (M)
3129 611.9716 1832.8930 1832.8913 0.90 0 6 1 +1Score > 24 indicates identity
Score > 18 indicates homology		 EVLSMVHQTMKPDFR + Oxidation (M)
3460 780.3602 2338.0588 2338.0707 -5.09 1 6 0.36 +1Score > 23 indicates identity
Score > 14 indicates homology		 NLTDAVANGSVSSERLDDMATR + Deamidated (NQ); Oxidation (M)
2517 604.8224 1207.6302 1207.6462 -13.2 1 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology		 VGFINEFARR
4123 838.8878 5027.2831 5027.3416 -11.6 0 5 1.4 +1Score > 19 indicates identity MAPSASATSAASQQSGGHLAGGTDIIIPYYVYPADGAWTPLEQLCTMR + Deamidated (NQ); Oxidation (M)
4275 801.4216 5602.9003 5602.8458 9.73 0 5 0.53 +1Score > 15 indicates identity DLSAGETIVEASIQAFGPNIDILVNNAGVEVVKPLSDLTVEDYNLVYDLNVR + 2 Deamidated (NQ)
3046 580.9555 1739.8447 1739.8115 19.1 1 5 1 +1Score > 24 indicates identity
Score > 18 indicates homology		 DAQGNKLSGFDVDAFR + Deamidated (NQ)
4392 892.7183 6241.9772 6241.9802 -0.49 1 5 1.2 +1Score > 19 indicates identity TFNEQALQYVVENISEQTGWLLEIVNYNVANMQYVAAGDLRALDCLTNLLNYLK + 8 Deamidated (NQ)
4014 997.9634 3987.8245 3987.7956 7.25 0 5 0.92 +1Score > 22 indicates identity
Score > 17 indicates homology		 MQSQQPIPQPQPSPPEGTHNASQFELEQPSLPATDR + 5 Deamidated (NQ); Oxidation (M)
4011 993.9675 3971.8409 3971.8007 10.1 0 5 0.7 +1Score > 22 indicates identity
Score > 16 indicates homology		 MQSQQPIPQPQPSPPEGTHNASQFELEQPSLPATDR + 5 Deamidated (NQ)
Page: 1 2 3 4 5 6 … 45 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/