MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1231_JBEI_1.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 1 May 2025 at 20:38:15 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,476

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 11)


Page: 1 2 Next 

+1

Accession Score Description
1 IGF1_BOVIN 166 Insulin-like growth factor 1 OS=Bos taurus OX=9913 GN=IGF1 PE=1 SV=2 Gly50-Ala119 Histag TEV fused with GFP with secretion signal

+2

Accession Score Description
1 TRYP_PIG 146 Trypsin OS=Sus scrofa PE=1 SV=1

+3

Accession Score Description
1 Q2UHT2_ASPOR 31 PWWP domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000322 PE=4 SV=1

-4

Accession Score Description
1 Q2TXG3_ASPOR 27 PKS_AT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000156 PE=3 SV=1
Score Mass Matches Sequences emPAI
4.1 Q2TXG3_ASPOR 27 225144 4 (1) 3 (1) 0.01
PKS_AT domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090010000156 PE=3 SV=1

-4 peptide matches (3 non-duplicate, 1 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
D:\Xcalibur\Data\Jennifer\20250430 PRT1231 Ofer\PRT1231_JBEI_1.raw

Score > 20 indicates identity

3.92 0 50 5.7e-005 1 VATVSLPR   (match in 2)
-9.41 1 15 0.2 2 VDRIALR  
-9.41 1 13 0.32 3 ITRSIPR  
3.95 1 9 0.74 4 LQKSLPR   + Deamidated (NQ)
17.3 0 8 1 5 VLGTLPDK  
-9.41 1 8 1.1 6 VAVLERR  
3.92 0 6 1.6 7 VSGTLPLR  
2237 +1 421.7600 841.5054 841.5134 -9.39 1 6 1.7 -8Score > 20 indicates identity U R.VAALNARK.A
3.92 0 5 2.1 9 AVLPVSTR  
-9.41 1 5 2.1 10 VDIRALR  
2410   505.2711 1008.5276 1008.5426 -14.8 0 27 0.019 +1Score > 22 indicates identity U R.MVLSVAAYR.E
4294   802.2421 5608.6438 5608.6169 4.79 1 3 2.5 +2Score > 19 indicates identity U R.CSNLYLVVGSGFGQADQMHPYITGEWSLSFGRPVMPCDGILIGSRMMVAR.E + Deamidated (NQ); 3 Oxidation (M)

+5

Accession Score Description
1 Q2U1P7_ASPOR 26 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090138000147 PE=4 SV=1

+6

Accession Score Description
1 Q2TYT6_ASPOR 25 Uncharacterized protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090103000116 PE=4 SV=1

+7

Accession Score Description
1 Q2U7W3_ASPOR 22 PH domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090701000677 PE=4 SV=1

+8

Accession Score Description
1 UBA4_ASPOR 20 Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=uba4 PE=3 SV=1

+9

Accession Score Description
1 AT222_ASPOR 19 Autophagy-related protein 22-2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atg22-2 PE=3 SV=2

+10

Accession Score Description
1 Q2UA72_ASPOR 16 5'-3' exoribonuclease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090102000515 PE=3 SV=1
Page: 1 2 Next 

Not what you expected? Try the select summary.