Mascot Search Results

User            : Mel Anogaster
Email           : [email protected]
Search title    : Time flies like an arrow
MS data file    : U:\Docs\Quantitation\iTRAQ\cantab\denisef28QSTARcor.mgf
Database        : SwissProt 51.6 (257964 sequences; 93947433 residues)
Quantitation    : iTRAQ 4plex   method details
                : Applied Biosystems iTRAQ(TM) reagent
Timestamp       : 19 Feb 2007 at 14:31:55 GMT



Protein hits    : 115/114  116/114  117/114   


 0.9141.4381.809 APLP_DROME Apolipophorins precursor (Retinoid- and fatty acid-binding glycoprotein) [Contains: Apolipophorin-2


 1.7612.2453.225 VIT3_DROME Vitellogenin-3 precursor (Vitellogenin III) (Yolk protein 3) - Drosophila melanogaster (Fruit fly)


 1.8913.2211.717 PDI_DROME Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI) - Drosophila melanogaster (Fruit fly)


 1.0201.1910.684 UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase precursor (EC 2.4.1.-) (UDP--Glc:glycoprotein glucosyl


 0.8461.6563.233 EF11_DROME Elongation factor 1-alpha (EF-1-alpha) (50 kDa female-specific protein) - Drosophila melanogaster (


 1.0964.0046.741 TOP2_DROME DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II) - Drosophila melanogaster (Fruit fly)


 0.9691.2212.165 RL4_DROME 60S ribosomal protein L4 (L1) - Drosophila melanogaster (Fruit fly)


 1.0422.0083.426 VDAC_DROME Voltage-dependent anion-selective channel (Porin) (DmVDAC) - Drosophila melanogaster (Fruit fly)


 1.4221.9061.335 HSP7C_DROME Heat shock 70 kDa protein cognate 3 precursor (78 kDa glucose-regulated protein homolog) (GRP 78) (


 1.0901.8391.182 YL_DROME Putative vitellogenin receptor precursor (Protein yolkless) (YL) - Drosophila melanogaster (Fruit f


 1.4112.1660.928 SPTCA_DROME Spectrin alpha chain - Drosophila melanogaster (Fruit fly)


 0.3570.8311.733 ATPB_DROME ATP synthase subunit beta, mitochondrial precursor (EC 3.6.3.14) - Drosophila melanogaster (Fruit f


 1.0512.1722.501 GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein (Receptor of activated protein kinase 


 0.7471.3632.370 RS3_DROME 40S ribosomal protein S3 - Drosophila melanogaster (Fruit fly)


 1.1741.1601.554 VIT1_DROME Vitellogenin-1 precursor (Vitellogenin I) (Yolk protein 1) - Drosophila melanogaster (Fruit fly)


 1.5773.0605.007 RL13_DROME 60S ribosomal protein L13 (BBC1 protein homolog) - Drosophila melanogaster (Fruit fly)


 1.2141.0970.717 CALR_DROME Calreticulin precursor (CRP55) (Calregulin) (HACBP) - Drosophila melanogaster (Fruit fly)


 0.8551.9193.548 KPYK_DROME Pyruvate kinase (EC 2.7.1.40) (PK) - Drosophila melanogaster (Fruit fly)


 0.7560.7522.068 PABP_DROME Polyadenylate-binding protein (Poly(A)-binding protein) (PABP) - Drosophila melanogaster (Fruit fly


 1.2561.9582.789 RL9_DROME 60S ribosomal protein L9 - Drosophila melanogaster (Fruit fly)


 --------- LAMC1_DROME Laminin subunit gamma-1 precursor (Laminin B2 chain) - Drosophila melanogaster (Fruit fly)


 1.4921.4131.066 FAS1_DROME Fasciclin-1 precursor (Fasciclin I) (FAS I) (FCN) - Drosophila melanogaster (Fruit fly)


 1.4424.7219.121 H2B_ACRFO Histone H2B - Acropora formosa (Staghorn coral)


 0.8361.0102.175 RS15A_DROME 40S ribosomal protein S15Aa - Drosophila melanogaster (Fruit fly)


 1.2651.4941.102 PERC_DROME Chorion peroxidase precursor (EC 1.11.1.7) (Peroxinectin-related protein) (Dpxt) [Contains: Chorion


 0.8110.7821.708 RS2_DROME 40S ribosomal protein S2 (Protein strings of pearls) - Drosophila melanogaster (Fruit fly)


 0.6261.4961.930 ATPA_DROME ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) (Protein bellwether) - Drosophila


 --------- GOSR1_DROME Probable 28 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 1) - Drosophila melanogaste


 1.3580.8301.482 VIT2_DROME Vitellogenin-2 precursor (Vitellogenin II) (Yolk protein 2) - Drosophila melanogaster (Fruit fly)


 --------- ATPA_HUMAN ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) - Homo sapiens (Human)

Mascot Score Histogram

Ions score is -10*Log(P), where P is the probability that the observed match is a random event.
Individual ions scores > 43 indicate identity or extensive homology (p<0.05).
Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein hits.

Score Distribution

Peptide Summary Report

  Help
  Significance threshold p< Max. number of hits  
  Standard scoring  MudPIT scoring  Ions score or expect cut-off Show sub-sets
  Show pop-ups  Suppress pop-ups  Sort unassigned Require bold red
  Protein ratio type Normalisation Help
  Report peptide ratios Outlier removal Min. # peptides
  Min. precursor charge Peptide threshold
  Unique peptides only    

        Error tolerant   

1.    APLP_DROME    Mass: 417818   Score: 695    Matches: 28(3)  Sequences: 26(3)  emPAI: 0.04
 Apolipophorins precursor (Retinoid- and fatty acid-binding glycoprotein) [Contains: Apolipophorin-2
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.914  4  1.096
         116/114  1.438  4  1.595
         117/114  1.809  4  1.465

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
1   402.2509   802.4872   802.5520   -0.0647 0  (11) 96 1  U   --- --- ---  K.AIALK.G
2   402.3000   802.5854   802.5520   0.0335 0  34  0.5 1  U   -46.450 -62.180 -64.716  K.AIALK.G
3   415.2975   828.5804   828.5676   0.0128 0  18  13 1  U   --- --- ---  K.LALPK.R
7   445.3178   888.6210   888.5888   0.0323 0  15  50 1  U   --- --- ---  R.LDLLK.E
12   451.7804   901.5462   901.5476   -0.0014 0  20  11 1  U   --- --- ---  R.LPEQK.V
13   470.2775   938.5404   938.5680   -0.0276 0  25  3.3 1  U   --- --- ---  K.LLDYK.N
17   477.7894   953.5642   953.5426   0.0217 0  17  19 1  U   --- --- ---  K.FSDGLK.H
20   481.8108   961.6070   961.6415   -0.0345 0  23  8.2 1  U   --- --- ---  K.LISTLK.T
35   494.4315   986.8484   986.6732   0.1753 0  30  0.062 1  U   --- --- ---  K.LNLIVK.N
36   495.8175   989.6204   989.6113   0.0091 0  19  18 1  U   --- --- ---  K.NGLGTLK.I
37   495.8362   989.6578   989.6364   0.0214 0  33  0.76 1  U   --- --- ---  K.SLELLK.N
42   504.3083   1006.6020   1006.5902   0.0118 0  15  46 1  U   --- --- ---  R.GLSVSEK.F
46   512.8149   1023.6152   1023.5957   0.0196 0  34  0.47 1  U   --- --- ---  K.ALSGNFK.L
47   513.2959   1024.5772   1023.5957   0.9816 0  (9) 1.4e+002 1  U   --- --- ---  K.ALSGNFK.L
49   518.8497   1035.6848   1035.6936   -0.0087 0  24  6.3 1  U   --- --- ---  R.IVYILK.G
57   554.8281   1107.6416   1107.6280   0.0136 0  15  50 1  U   --- --- ---  R.VAFNANGK.L
63   562.8259   1123.6372   1123.6481   -0.0108 0  27  2.2 1  U   --- --- ---  K.NIDFSLK.A
65   565.3086   1128.6026   1128.5906   0.0120 0  22  7.4 1  U   --- --- ---  R.SDSLEYK.N
66   569.8121   1137.6096   1137.6129   -0.0033 0  57  0.0024 1  U   1.017 1.266 2.398  K.ACDIALAK.V
67   569.8129   1137.6112   1137.5910   0.0203 0  31  0.91 1  U   --- --- ---  K.EAGPDFSK.L
68   571.3262   1140.6378   1140.6383   -0.0004 0  21  7.9 1  U   --- --- ---  K.SSTFVANK.K
77   588.3564   1174.6982   1174.7318   -0.0335 0  41  0.12 1  U   0.831 2.528 3.080  K.VTQWILK.V
90   608.8473   1215.6800   1215.6703   0.0098 0  7  2.4e+002 1  U   --- --- ---  K.GIAPQADEK.A
92   609.3931   1216.7716   1216.7383   0.0334 0  47  0.026 1  U   0.876 0.965 1.169  K.VGNANIITK.A
97   628.3483   1254.6820   1254.6700   0.0121 0  35  0.36 1  U   --- --- ---  K.LDYSTPGSK.V
98   628.3753   1254.7360   1254.7063   0.0297 0  30  1.3 1  U   --- --- ---  K.SEISYQIK.Q
123   678.3704   1354.7262   1354.7159   0.0104 0  50  0.013 1  U   1.168 5.553 5.462  K.IMSNFDVNK.M
125   683.9102   1365.8058   1365.8111   -0.0053 0  32  0.79 1  U   --- --- ---  R.ILDIYNSLK.E

2.    VIT3_DROME    Mass: 50436    Score: 515    Matches: 19(4)  Sequences: 13(4)  emPAI: 1.13
 Vitellogenin-3 precursor (Vitellogenin III) (Yolk protein 3) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.761  10  1.144
         116/114  2.245  10  1.560
         117/114  3.225  11  2.065

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
54   534.7767   1067.5388   1067.5491   -0.0103 0  38  0.2 1  U   1.962 15.529 15.409  K.EQDGFGK.R
96   625.8919   1249.7692   1249.7638   0.0055 0  36  0.35 1  U   2.148 2.180 3.490  R.LIQAYVQK.Y
114   661.8789   1321.7432   1321.7597   -0.0165 0  34  0.52 1  U   1.929 1.519 2.946  K.YNLQQLQK.N
118   670.3865   1338.7584   1338.7387   0.0198 0  (19) 17 1  U   --- --- ---  K.LNNYVETAK.A
119   670.3867   1338.7588   1338.7387   0.0202 0  57  0.0023 1  U   1.912 1.956 3.475  K.LNNYVETAK.A
134   705.4144   1408.8142   1408.7805   0.0337 0  68  0.00018 1  U   1.827 5.873 10.012  R.GDYILEVNAK.S
143   723.4282   1444.8418   1444.8282   0.0137 0  35  0.4 1  U   1.174 0.851 1.783  R.NFPAVPANSLK.Q
147   751.8827   1501.7508   1501.8092   -0.0584 0  18  17 1  U   --- --- ---  K.NAQEQQQQLK.S
148   757.9334   1513.8522   1513.8344   0.0179 0  42  0.077 1  U   3.981 4.020 6.726  R.LENQPLEQGAK.V
166   1119.1100   2236.2054   2236.2558   -0.0504 0  61  0.00089 1  U   1.773 7.411 11.119  K.AASGDLIIIDLGSTLTNFK.R
172   789.3806   2365.1200   2365.1495   -0.0295 0  70  6.7e-005 1  U   1.121 0.964 2.058  R.GDADFVDAIHTSTFAMGTPIR.C
173   789.3896   2365.1470   2365.1495   -0.0025 0  (29) 1.1 1  U   0.995 1.113 1.314  R.GDADFVDAIHTSTFAMGTPIR.C
174   789.3903   2365.1491   2365.1495   -0.0004 0  (3) 3.8e+002 1  U   --- --- ---  R.GDADFVDAIHTSTFAMGTPIR.C
175   789.7163   2366.1271   2365.1495   0.9776 0  (10) 81 1  U   --- --- ---  R.GDADFVDAIHTSTFAMGTPIR.C
222   1028.8178   3083.4316   3083.4572   -0.0257 0  (17) 7.8 1  U   --- --- ---  R.CGDVDFYPNGPSTGVPGSENVIEAVAR.A + iTRAQ4plex (Y)
223   1029.1577   3084.4513   3083.4572   0.9940 0  25  1.5 1  U   --- --- ---  R.CGDVDFYPNGPSTGVPGSENVIEAVAR.A + iTRAQ4plex (Y)
224   1090.1604   3267.4594   3267.5411   -0.0817 1  9  27 1  U   --- --- ---  R.CGDVDFYPNGPSTGVPGSENVIEAVARATR.Y
229   1294.9831   3881.9275   3882.0043   -0.0768 1  (21) 4 1  U   1.261 0.026 0.037  K.WLTATELENVPSLNDITWERLENQPLEQGAK.V
230   971.4973   3881.9601   3882.0043   -0.0442 1  22  3.4 1  U   --- --- ---  K.WLTATELENVPSLNDITWERLENQPLEQGAK.V

3.    PDI_DROME    Mass: 63614    Score: 466    Matches: 16(2)  Sequences: 14(2)  emPAI: 0.46
 Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.891  7  1.260
         116/114  3.221  7  1.405
         117/114  1.717  7  1.271

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
5   434.2668   866.5190   866.5105   0.0085 0  16  24 1  U   --- --- ---  K.FLDGK.L
21   483.8025   965.5904   965.5789   0.0115 0  12  77 1  U   --- --- ---  R.GYPTLK.F
43   505.3096   1008.6046   1008.6212   -0.0165 0  24  4.8 1  U   --- --- ---  K.IFGGSIK.S
62   562.3162   1122.6178   1122.5834   0.0344 0  37  0.25 1  U   1.253 7.084 3.347  K.LEEDMAK.Y
64   563.3354   1124.6562   1124.6321   0.0241 0  35  0.34 1  U   --- --- ---  R.TLDDFVK.F
70   575.8435   1149.6724   1149.6637   0.0087 0  40  0.14 1      --- --- ---  K.ALAPEYAK.A
78   590.8511   1179.6876   1179.7107   -0.0230 0  37  0.26 1  U   2.357 2.628 1.612  K.ISSFPTIK.Y
79   590.8668   1179.7190   1179.7107   0.0084 0  (20) 12 1  U   --- --- ---  K.ISSFPTIK.Y
136   710.8518   1419.6890   1419.7464   -0.0574 0  27  2.5 1  U   --- --- ---  R.IFEFFGMNK.E
137   710.8655   1419.7164   1419.7464   -0.0300 0  (21) 10 1  U   --- --- ---  R.IFEFFGMNK.E
149   777.9259   1553.8372   1553.8697   -0.0325 0  18  20 1  U   --- --- ---  K.DNEIAIIGFFK.D
152   813.4086   1624.8026   1624.8221   -0.0195 0  56  0.0027 1  U   1.890 2.233 1.190  K.MDSTANELESIK.I
153   838.9692   1675.9238   1675.9388   -0.0150 0  33  0.59 1  U   2.240 2.395 1.911  K.QLAPIYDQLAEK.Y
155   898.4571   1794.8996   1794.9243   -0.0247 0  54  0.0039 1  U   1.738 6.047 2.398  K.SVFEGELNEENLK.K
156   904.5188   1807.0230   1806.9971   0.0259 0  41  0.086 1  U   0.724 7.117 2.588  K.VEEGVLVATVDNFK.Q
193   840.1033   2517.2881   2517.3471   -0.0590 0  39  0.13 1  U   0.721 0.995 0.717  K.FAQVQSLPLIVDFNHESASK.I

4.    UGGG_DROME    Mass: 187242   Score: 359    Matches: 11(4)  Sequences: 11(4)  emPAI: 0.14
 UDP-glucose:glycoprotein glucosyltransferase precursor (EC 2.4.1.-) (UDP--Glc:glycoprotein glucosyl
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.020  6  1.126
         116/114  1.191  6  2.124
         117/114  0.684  6  1.849

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
48   514.8051   1027.5956   1027.6099   -0.0142 0  25  3.2 1      --- --- ---  K.FWFLK.N
52   530.3192   1058.6238   1058.6368   -0.0129 0  26  2.6 1  U   --- --- ---  R.IVPEWK.D
93   610.3666   1218.7186   1218.7063   0.0123 0  60  0.0014 1  U   1.185 1.980 1.032  R.ILSQEDVK.Y
112   659.3589   1316.7032   1316.7220   -0.0187 0  51  0.01 1  U   1.106 1.665 1.058  K.EFTSLSFAK.A
116   669.8721   1337.7296   1337.7434   -0.0138 0  57  0.0025 1  U   1.482 3.052 1.746  R.AVYDLDNIK.L
124   681.8485   1361.6824   1361.7071   -0.0246 0  23  6.8 1  U   --- --- ---  R.FSSLQYSDK.V
160   683.0182   2046.0328   2046.0504   -0.0176 0  17  24 1  U   -46.450 -119.197 -86.360  R.DLLTHALDYVQSGESVR.V
200   884.4434   2650.3084   2649.3642   0.9442 1  17  15 1  U   0.797 0.059 0.069  R.YVVEPEVQFEANGGRSDGPLAK.F
201   891.4331   2671.2775   2671.2856   -0.0081 0  46  0.015 1  U   0.762 5.963 2.775  K.GELTDNDVAIDYLMNQPHVMPR.L
209   1009.1166   3024.3280   3024.4110   -0.0830 1  8  29 1  U   --- --- ---  K.AEEFLEEDSTYDYGRELAAEFIQR.L
227   1247.2850   3738.8332   3738.8879   -0.0547 0  31  0.39 1  U   0.936 0.810 0.433  R.GQYQALSQDPNSLSNLDQDLPNNMIHQVAIK.S

5.    EF11_DROME    Mass: 57566    Score: 274    Matches: 10(2)  Sequences: 8(2)  emPAI: 0.35
 Elongation factor 1-alpha (EF-1-alpha) (50 kDa female-specific protein) - Drosophila melanogaster (
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.846  6  1.268
         116/114  1.656  6  1.361
         117/114  3.233  6  1.334

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
9   448.2874   894.5602   894.5418   0.0184 0  25  3 1      --- --- ---  K.FAEIK.E
22   485.2865   968.5584   968.5422   0.0162 0  14  48 1      --- --- ---  R.YEEIK.K
55   542.8043   1083.5940   1083.5804   0.0136 0  21  9.3 1      --- --- ---  R.GYVAGDSK.A
58   557.3304   1112.6462   1112.6321   0.0142 0  40  0.11 1      0.750 1.762 4.020  K.EVSSYIK.K
71   579.8455   1157.6764   1157.7376   -0.0611 0  (32) 0.71 1      --- --- ---  K.QLIVGVNK.M
72   579.8761   1157.7376   1157.7376   0.0001 0  40  0.096 1      1.434 3.169 5.317  K.QLIVGVNK.M
84   601.9025   1201.7904   1201.7638   0.0266 0  52  0.0074 1      0.696 0.840 1.410  R.QTVAVGVIK.A
165   736.7677   2207.2813   2207.2769   0.0044 1  41  0.079 1  U   0.928 1.014 1.872  K.TLIDALDAILPPARPTDK.A
225   1096.9054   3287.6944   3287.7290   -0.0346 1  42  0.047 1  U   0.496 0.714 1.966  K.SGDAAIVNLVPSKPLCVEAFQEFPPLGR.F
226   1097.2586   3288.7540   3287.7290   1.0250 1  (20) 7.3 1  U   0.451 1.465 1.959  K.SGDAAIVNLVPSKPLCVEAFQEFPPLGR.F

6.    TOP2_DROME    Mass: 188379   Score: 267    Matches: 10(1)  Sequences: 10(1)  emPAI: 0.08
 DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.096  4  1.217
         116/114  4.004  4  1.314
         117/114  6.741  4  1.280

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
4   432.2781   862.5416   862.5368   0.0049 0  14  90 1  U   --- --- ---  K.LTDVK.K
31   488.2965   974.5784   974.5680   0.0104 0  10  1.6e+002 1  U   --- --- ---  R.YLYTK.G
69   571.3290   1140.6434   1140.6205   0.0230 0  27  1.9 1  U   --- --- ---  K.FINNMSK.S
88   605.3054   1208.5962   1208.6000   -0.0037 0  27  2.4 1  U   0.848 3.284 5.675  K.VMFTCFK.R
99   628.8074   1255.6002   1255.6218   -0.0215 0  32  0.62 1  U   0.899 2.964 4.751  K.AMCDELLK.R
110   645.3854   1288.7562   1288.7230   0.0332 0  26  3.1 1  U   --- --- ---  R.AEEQGINLK.T
111   646.3451   1290.6756   1290.6659   0.0097 0  56  0.0039 1  U   1.177 8.996 13.735  K.LEDANEAGGK.N
142   720.9032   1439.7918   1439.8268   -0.0349 0  29  1.5 1  U   --- --- ---  K.EISFVPGLYK.I
146   749.8950   1497.7754   1497.8105   -0.0350 0  40  0.12 1  U   1.910 3.502 7.736  K.ALSIEQMYQK.K
184   833.3796   2497.1170   2497.1634   -0.0464 0  10  41 1  U   --- --- ---  K.LTTTLSTNQMHAFDQNNCLR.R

7.    RL4_DROME    Mass: 51286    Score: 249    Matches: 9(2)  Sequences: 6(2)  emPAI: 0.31
 60S ribosomal protein L4 (L1) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.969  4  1.459
         116/114  1.221  4  1.653
         117/114  2.165  4  1.693

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
 73   581.3367   1160.6588   1160.6797   -0.0209 0  (17) 29 10  U   --- --- ---  K.IWADIQK.V
74   581.3370   1160.6594   1160.6797   -0.0203 0  24  5.8 1  U   --- --- ---  K.IWADIQK.V
85   602.8577   1203.7008   1203.6855   0.0153 0  23  7.7 1  U   --- --- ---  K.GYNLPQPK.M
115   667.8921   1333.7696   1333.7849   -0.0152 0  45  0.043 1  U   0.935 1.252 1.959  K.LNPYAEVLK.R
117   669.8744   1337.7342   1337.7443   -0.0101 0  42  0.074 1  U   1.628 1.799 4.183  K.NICLPAVFK.A
129   691.3824   1380.7502   1380.7645   -0.0143 0  (6) 3.2e+002 1  U   --- --- ---  R.LNDLFGTWK.K
130   691.3875   1380.7604   1380.7645   -0.0041 0  33  0.6 1  U   2.817 4.900 9.508  R.LNDLFGTWK.K
131   691.8840   1381.7534   1380.7645   0.9889 0  (9) 1.5e+002 1  U   --- --- ---  R.LNDLFGTWK.K
182   817.3921   2449.1545   2449.1744   -0.0199 0  83  3.1e-006 1  U   0.705 0.701 1.389  R.QAYAVSELAGHQTSAESWGTGR.A

8.    VDAC_DROME    Mass: 34278    Score: 246    Matches: 11(2)  Sequences: 6(2)  emPAI: 0.35
 Voltage-dependent anion-selective channel (Porin) (DmVDAC) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.042  5  1.078
         116/114  2.008  3  1.044
         117/114  3.426  5  1.362

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
8   447.7945   893.5744   893.5578   0.0166 0  42  0.079 1  U   0.974 2.116 3.304  K.FAIGAK.Y
11   449.2780   896.5414   896.5211   0.0203 0  25  2.7 1      --- --- ---  R.DIFSK.G
76   584.8312   1167.6478   1167.6743   -0.0265 0  52  0.0073 1  U   1.060 3.239 5.353  K.VFGSLETK.Y
113   661.8683   1321.7220   1321.7121   0.0099 0  18  21 1  U   --- --- ---  M.APPSYSDLGK.Q
128   689.3609   1376.7072   1376.7391   -0.0318 0  39  0.16 1  U   --- --- ---  K.ADSDVNIDLK.G
187   837.7135   2510.1187   2510.2312   -0.1125 0  (3) 2e+002 1  U   --- --- ---  K.DFVLHTAVNDGQEFSGSIFQR.T
188   837.7512   2510.2318   2510.2312   0.0006 0  (16) 19 1  U   --- --- ---  K.DFVLHTAVNDGQEFSGSIFQR.T
189   837.7575   2510.2507   2510.2312   0.0195 0  69  0.0001 1  U   1.070 1.899 2.094  K.DFVLHTAVNDGQEFSGSIFQR.T
190   838.0665   2511.1777   2510.2312   0.9465 0  (21) 5.5 1  U   1.314 2.126 1.549  K.DFVLHTAVNDGQEFSGSIFQR.T
191   838.0981   2511.2725   2510.2312   1.0413 0  (15) 29 1  U   --- --- ---  K.DFVLHTAVNDGQEFSGSIFQR.T
192   838.0994   2511.2764   2510.2312   1.0452 0  (24) 3.8 1  U   0.932 0.902 1.493  K.DFVLHTAVNDGQEFSGSIFQR.T

9.    HSP7C_DROME    Mass: 81675    Score: 242    Matches: 16(0)  Sequences: 8(0)  emPAI: 0.19
 Heat shock 70 kDa protein cognate 3 precursor (78 kDa glucose-regulated protein homolog) (GRP 78) (
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.422  5  1.275
         116/114  1.906  5  2.066
         117/114  1.335  5  1.832

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
18   479.7610   957.5074   957.5164   -0.0089 0  32  0.67 1  U   --- --- ---  K.DFFGGK.E
23   487.2849   972.5552   972.5677   -0.0124 0  (22) 7.6 1  U   --- --- ---  K.FFPFK.V
24   487.2879   972.5612   972.5677   -0.0064 0  (27) 2.6 1  U   --- --- ---  K.FFPFK.V
25   487.2886   972.5626   972.5677   -0.0050 0  (27) 2.7 1  U   --- --- ---  K.FFPFK.V
26   487.2901   972.5656   972.5677   -0.0020 0  (21) 9.8 1  U   --- --- ---  K.FFPFK.V
27   487.2907   972.5668   972.5677   -0.0008 0  (26) 2.8 1  U   --- --- ---  K.FFPFK.V
28   487.2913   972.5680   972.5677   0.0004 0  28  2.1 1  U   --- --- ---  K.FFPFK.V
29   487.2916   972.5686   972.5677   0.0010 0  (24) 5 1  U   --- --- ---  K.FFPFK.V
30   487.2930   972.5714   972.5677   0.0038 0  (27) 2.6 1  U   --- --- ---  K.FFPFK.V
32   488.3104   974.6062   974.6004   0.0058 0  (42) 0.087 1      1.028 1.154 0.885  R.LIGDAAK.N
33   488.3160   974.6174   974.6004   0.0170 0  43  0.079 1      1.780 1.962 1.273  R.LIGDAAK.N
40   497.7745   993.5344   993.5222   0.0122 0  22  6.9 1  U   --- --- ---  K.LSDDEK.N
109   643.3261   1284.6376   1283.7087   0.9290 1  8  1.7e+002 1  U   --- --- ---  K.FADEDKK.L
151   802.9103   1603.8060   1603.8337   -0.0276 0  41  0.09 1  U   2.544 14.908 10.039  R.NELESYAYSLK.N
154   889.9741   1777.9336   1777.9892   -0.0555 0  36  0.3 1  U   1.074 0.597 0.998  K.VFAPEEISAMVLGK.M
159   678.0216   2031.0430   2031.0660   -0.0230 0  33  0.57 1  U   1.057 1.474 1.142  K.VTHAVVTVPAYFNDAQR.Q

10.   YL_DROME    Mass: 235777   Score: 241    Matches: 7(4)  Sequences: 6(3)  emPAI: 0.08
 Putative vitellogenin receptor precursor (Protein yolkless) (YL) - Drosophila melanogaster (Fruit f
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.090  6  1.156
         116/114  1.839  6  1.279
         117/114  1.182  6  1.389

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
10   448.7577   895.5008   895.4863   0.0146 0  41  0.083 1  U   1.318 3.016 2.339  K.CALGAK.C
44   506.3159   1010.6172   1010.6004   0.0168 0  30  1.2 1  U   0.745 1.713 1.094  R.AVVYGSK.E
80   591.8372   1181.6598   1181.6688   -0.0090 0  53  0.0058 1  U   1.037 1.284 0.497  R.IYWVDAK.L
91   608.8719   1215.7292   1215.7219   0.0073 0  21  9.6 1  U   --- --- ---  R.SLAVWPQK.G
163   718.7104   2153.1094   2153.1602   -0.0509 0  43  0.05 1  U   0.838 1.116 0.584  R.LILEFQPESHESNVLVR.S
195   850.1092   2547.3058   2547.3133   -0.0076 0  55  0.0027 1  U   1.249 0.912 0.987  K.EQQPLLLYTTQMTIMGMHLR.E
196   850.4261   2548.2565   2547.3133   0.9431 0  (43) 0.044 1  U   0.784 1.432 1.207  K.EQQPLLLYTTQMTIMGMHLR.E

11.   SPTCA_DROME    Mass: 305140   Score: 234    Matches: 7(2)  Sequences: 7(2)  emPAI: 0.05
 Spectrin alpha chain - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.411  4  1.151
         116/114  2.166  3  1.086
         117/114  0.928  4  1.185

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
38   496.3088   990.6030   990.5953   0.0077 0  43  0.085 1  U   1.229 2.099 0.670  K.LNETVK.A
45   510.8068   1019.5990   1019.5684   0.0307 0  21  13 1  U   --- --- ---  R.FQYFK.R
60   559.3554   1116.6962   1116.6746   0.0216 0  44  0.056 1  U   1.566 2.114 0.993  K.ALAALDQK.I
75   583.8476   1165.6806   1165.6950   -0.0144 0  52  0.0075 1  U   1.186 1.662 1.222  K.ALDIFATK.L
86   604.2999   1206.5852   1206.6021   -0.0168 0  24  5.4 1  U   --- --- ---  K.EFSMMFK.H
138   716.4036   1430.7926   1430.8125   -0.0199 0  47  0.025 1  U   2.056 2.650 1.339  K.ALNQAWAELK.N
208   1005.2279   3012.6619   3012.6123   0.0495 0  8  1.4e+002 1  U   --- --- ---  K.IAALQTVADQLIAQNHYASNLVDEK.R

12.   ATPB_DROME    Mass: 57821    Score: 229    Matches: 8(2)  Sequences: 7(2)  emPAI: 0.27
 ATP synthase subunit beta, mitochondrial precursor (EC 3.6.3.14) - Drosophila melanogaster (Fruit f
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.357  3  1.277
         116/114  0.831  3  1.889
         117/114  1.733  3  2.502

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
53   534.3265   1066.6384   1066.6266   0.0118 0  24  4.6 1      --- --- ---  K.ILQDYK.S
 101   632.3753   1262.7360   1262.7591   -0.0230 0  (14) 59 2      --- --- ---  K.IGLFGGAGVGK.T
102   632.3754   1262.7362   1262.7591   -0.0228 0  52  0.0099 1      0.343 0.898 1.968  K.IGLFGGAGVGK.T
127   688.9220   1375.8294   1375.8319   -0.0024 0  29  1.8 1      --- --- ---  K.VVDLLAPYAK.G
157   911.5083   1821.0020   1821.0230   -0.0210 0  54  0.0046 1  U   0.578 1.101 1.133  R.LVLEVAQHLGENTVR.T
164   724.4082   2170.2028   2170.2232   -0.0204 1  23  5.4 1  U   0.400 0.300 0.278  K.VLDTGYPIRIPVGAETLGR.I
167   759.4138   2275.2196   2275.2303   -0.0108 0  29  1.4 1  U   --- --- ---  R.AIAELGIYPAVDPLDSTSR.I + iTRAQ4plex (Y)
207   983.1986   2946.5740   2946.5827   -0.0087 1  20  8.9 1  U   --- --- ---  K.SLQDIIAILGMDELSEEDKLTVAR.A

13.   GBLP_DROME    Mass: 38892    Score: 218    Matches: 5(2)  Sequences: 5(2)  emPAI: 0.43
 Guanine nucleotide-binding protein subunit beta-like protein (Receptor of activated protein kinase
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.051  4  1.089
         116/114  2.172  4  1.225
         117/114  2.501  4  1.192

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
50   524.3335   1046.6524   1046.6732   -0.0207 0  43  0.082 1  U   1.091 1.870 1.685  K.TLIVWK.L
73   581.3367   1160.6588   1160.6797   -0.0209 0  47  0.027 1  U   1.100 1.302 1.958  R.LWDLAAGK.T
108   641.3339   1280.6532   1280.6613   -0.0081 0  41  0.097 1  U   1.147 2.328 2.747  K.VWNLANCK.L
135   706.3727   1410.7308   1410.7243   0.0066 0  28  2 1  U   --- --- ---  K.LWNTLAECK.F
139   716.8920   1431.7694   1431.7965   -0.0271 0  59  0.0017 1  U   0.804 3.308 3.574  K.ALLWDLNDGK.N

14.   RS3_DROME    Mass: 31240    Score: 173    Matches: 6(0)  Sequences: 5(0)  emPAI: 0.73
 40S ribosomal protein S3 - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.747  5  1.061
         116/114  1.363  6  1.329
         117/114  2.370  6  1.230

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
41   501.8342   1001.6538   1001.6477   0.0061 0  36  0.29 1  U   0.721 1.116 2.017  R.QGVLGIK.V
81   595.8567   1189.6988   1189.6910   0.0078 0  43  0.072 1  U   0.763 0.976 2.190  K.TQQVLGEK.G
83   600.8417   1199.6688   1199.6794   -0.0106 0  35  0.33 1  U   0.845 2.120 3.991  K.FVSDGIFK.A
89   606.3040   1210.5934   1210.6294   -0.0359 0  22  6.7 1  U   0.665 2.897 2.772  K.GCEVVVSGK.L
197   877.3937   2629.1593   2629.1733   -0.0140 0  36  0.079 1  U   0.404 0.569 1.229  K.FVDGLMIHSGDPCNDYVETATR.H
198   877.7384   2630.1934   2629.1733   1.0201 0  (29) 0.6 1  U   0.629 1.470 1.503  K.FVDGLMIHSGDPCNDYVETATR.H

15.   VIT1_DROME    Mass: 52618    Score: 165    Matches: 12(3)  Sequences: 4(2)  emPAI: 0.22
 Vitellogenin-1 precursor (Vitellogenin I) (Yolk protein 1) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.174  4  1.254
         116/114  1.160  4  1.432
         117/114  1.554  4  1.263

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
103   635.8406   1269.6666   1269.6882   -0.0216 0  59  0.0015 1  U   1.538 1.708 2.120  R.YAMLDIEK.T
177   794.0542   2379.1408   2379.1651   -0.0243 0  (41) 0.057 1  U   0.655 0.583 0.990  R.GDAEFVDAIHTSVYGMGTPIR.S
178   794.0545   2379.1417   2379.1651   -0.0234 0  59  0.001 1  U   1.093 0.575 1.257  R.GDAEFVDAIHTSVYGMGTPIR.S
179   794.0552   2379.1438   2379.1651   -0.0213 0  (4) 2.8e+002 1  U   --- --- ---  R.GDAEFVDAIHTSVYGMGTPIR.S
180   794.3885   2380.1437   2379.1651   0.9786 0  (24) 3.3 1  U   --- --- ---  R.GDAEFVDAIHTSVYGMGTPIR.S
181   794.4063   2380.1971   2379.1651   1.0320 0  (30) 0.85 1  U   0.917 1.353 0.958  R.GDAEFVDAIHTSVYGMGTPIR.S
205   979.4765   2935.4077   2935.4378   -0.0301 0  36  0.15 1  U   --- --- ---  R.SGDVDFYPNGPAAGVPGASNVVEAAMR.A + iTRAQ4plex (Y)
206   979.8067   2936.3983   2935.4378   0.9605 0  (28) 0.86 1  U   --- --- ---  R.SGDVDFYPNGPAAGVPGASNVVEAAMR.A + iTRAQ4plex (Y)
231   1321.3248   3960.9526   3961.0135   -0.0609 1  12  32 1  U   --- --- ---  R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
232   991.2625   3961.0209   3961.0135   0.0074 1  (10) 49 1  U   --- --- ---  R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
233   1321.6645   3961.9717   3961.0135   0.9582 1  (4) 1.8e+002 1  U   --- --- ---  R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
234   991.5118   3962.0181   3961.0135   1.0046 1  (3) 2.4e+002 1  U   --- --- ---  R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L

16.   RL13_DROME    Mass: 29639    Score: 163    Matches: 5(3)  Sequences: 4(2)  emPAI: 0.26
 60S ribosomal protein L13 (BBC1 protein homolog) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.577  3  1.016
         116/114  3.060  3  1.074
         117/114  5.007  3  1.104

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
19   481.3213   960.6280   960.6211   0.0069 0  26  3.5 1  U   --- --- ---  K.LATQLK.G
82   597.3561   1192.6976   1192.6808   0.0169 0  48  0.021 1  U   1.636 3.591 6.213  K.GAGIGANFAK.T
126   687.9194   1373.8242   1373.8526   -0.0283 0  30  1.4 1  U   --- --- ---  K.LILFPINEK.K
132   693.8090   1385.6034   1385.6410   -0.0376 0  59  0.00081 1  U   1.563 2.915 4.743  R.AGESSLEECK.L
133   693.8436   1385.6726   1385.6410   0.0316 0  (50) 0.0099 1  U   1.562 2.956 4.658  R.AGESSLEECK.L

17.   CALR_DROME    Mass: 53540    Score: 160    Matches: 18(0)  Sequences: 5(0)  emPAI: 0.30
 Calreticulin precursor (CRP55) (Calregulin) (HACBP) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.214  7  1.090
         116/114  1.097  7  1.400
         117/114  0.717  7  1.276

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
105   640.3533   1278.6920   1278.6812   0.0109 0  (14) 51 1  U   --- --- ---  K.QLDNPNYK.G
106   640.3640   1278.7134   1278.6812   0.0323 0  37  0.27 1  U   1.469 1.255 1.118  K.QLDNPNYK.G
107   640.3642   1278.7138   1278.6812   0.0327 0  (23) 6.2 1  U   --- --- ---  K.QLDNPNYK.G
158   943.4634   1884.9122   1884.9722   -0.0599 0  32  0.56 1  U   0.926 1.109 0.837  K.EICTLGFDLWQVK.S
176   1189.5264   2377.0382   2377.0742   -0.0360 0  32  0.2 1  U   1.005 6.583 2.674  K.ENFDNENWEDTWIYSK.H
210   1011.4891   3031.4455   3031.5131   -0.0676 1  (8) 95 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
211   1011.4959   3031.4659   3031.5131   -0.0472 1  (27) 1.4 1  U   1.119 0.982 0.482  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
212   1011.4959   3031.4659   3031.5131   -0.0472 1  (15) 21 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
213   1011.5010   3031.4812   3031.5131   -0.0319 1  30  0.68 1  U   1.621 0.800 0.665  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
214   1011.5050   3031.4932   3031.5131   -0.0199 1  (12) 44 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
215   1011.5086   3031.5040   3031.5131   -0.0091 1  (11) 64 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
216   1011.5143   3031.5211   3031.5131   0.0080 1  (15) 24 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
217   1011.8282   3032.4628   3031.5131   0.9497 1  (9) 69 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
218   1011.8366   3032.4880   3031.5131   0.9749 1  (20) 7.2 1  U   1.116 0.730 0.559  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
219   759.1342   3032.5077   3031.5131   0.9946 1  (3) 3.9e+002 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
220   1011.8490   3032.5252   3031.5131   1.0121 1  (18) 12 1  U   1.098 0.667 0.841  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
221   1011.8869   3032.6389   3031.5131   1.1258 1  (3) 3.6e+002 1  U   --- --- ---  K.FVLTPGTFYNDAEADKGIQTSQDAR.F
228   1261.8890   3782.6452   3782.6349   0.0103 0  29  0.12 1  U   --- --- ---  K.LFDCSLDQTDMHGESPYEIMFGPDICGPGTK.K

18.   KPYK_DROME    Mass: 63726    Score: 144    Matches: 5(1)  Sequences: 4(1)  emPAI: 0.18
 Pyruvate kinase (EC 2.7.1.40) (PK) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.855  3  1.649
         116/114  1.919  3  2.035
         117/114  3.548  3  2.040

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
16   477.2865   952.5584   952.5473   0.0111 0  22  7 1      --- --- ---  K.EFLEK.G
51   527.8235   1053.6324   1053.6062   0.0262 0  24  4.3 1  U   --- --- ---  K.SAFQVSK.Y
101   632.3753   1262.7360   1262.7591   -0.0230 0  42  0.082 1  U   1.124 2.681 4.923  R.VQFGLQVGK.K
203   933.1154   2796.3244   2796.3656   -0.0412 0  56  0.0016 1  U   0.353 0.516 0.915  K.IENQQGMHNLDEIIEAGDGIMVAR.G
204   1399.6623   2797.3100   2796.3656   0.9444 0  (37) 0.096 1  U   0.515 0.897 1.989  K.IENQQGMHNLDEIIEAGDGIMVAR.G

19.   PABP_DROME    Mass: 76694    Score: 139    Matches: 5(1)  Sequences: 4(1)  emPAI: 0.15
 Polyadenylate-binding protein (Poly(A)-binding protein) (PABP) - Drosophila melanogaster (Fruit fly
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.756  3  1.180
         116/114  0.752  3  1.332
         117/114  2.068  3  1.041

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
87   604.8492   1207.6838   1207.7169   -0.0330 0  23  6.1 1  U   --- --- ---  R.SGVGNVFIK.N
104   636.3564   1270.6982   1270.7529   -0.0547 0  34  0.44 1  U   1.050 1.285 2.185  K.LFTNVYVK.N
161   703.3666   2107.0780   2107.0463   0.0317 0  (9) 1.4e+002 1  U   --- --- ---  R.GAQPQVQGTHAAAAAANNMR.N
162   703.3698   2107.0876   2107.0463   0.0413 0  55  0.0032 1  U   0.648 0.608 1.913  R.GAQPQVQGTHAAAAAANNMR.N
194   846.1394   2535.3964   2535.4165   -0.0202 0  26  2.5 1  U   0.643 0.515 2.091  R.NPPVPQLHQTQPIPQQLQGK.N

20.   RL9_DROME    Mass: 24542    Score: 127    Matches: 3(1)  Sequences: 3(1)  emPAI: 0.52
 60S ribosomal protein L9 - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.256  3  1.125
         116/114  1.958  2  1.104
         117/114  2.789  3  1.220

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
120   670.8644   1339.7142   1339.6832   0.0311 0  37  0.22 1  U   1.339 2.093 3.313  R.TINSNQCVK.I
144   729.9045   1457.7944   1457.8010   -0.0065 0  49  0.014 1  U   1.220 1.736 2.236  K.FLDGLYVSEK.T
202   894.1127   2679.3163   2679.3271   -0.0108 0  40  0.073 1  U   0.966 -0.143 1.912  R.AVYAHFPINCVTSENNTVIEIR.N

21.   LAMC1_DROME    Mass: 200079   Score: 125    Matches: 3(1)  Sequences: 3(1)  emPAI: 0.02
 Laminin subunit gamma-1 precursor (Laminin B2 chain) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  ---  1  ---
         116/114  ---  1  ---
         117/114  ---  1  ---

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
61   562.2309   1122.4472   1122.4574   -0.0101 0  30  0.56 1  U   --- --- ---  K.NCEFCK.Y
183   820.7388   2459.1946   2459.2414   -0.0468 0  67  0.00017 1  U   1.123 1.482 2.192  R.ATYSVQGEAILDDVELQTAHR.G
186   835.0141   2502.0205   2502.0050   0.0155 0  28  0.15 1  U   --- --- ---  R.GCIDCPDCYNLVQDAADLHR.A

22.   FAS1_DROME    Mass: 78934    Score: 124    Matches: 3(2)  Sequences: 3(2)  emPAI: 0.09
 Fasciclin-1 precursor (Fasciclin I) (FAS I) (FCN) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.492  2  1.093
         116/114  1.413  2  1.883
         117/114  1.066  2  1.859

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
39   497.3028   992.5910   992.5746   0.0164 0  27  3.1 1  U   --- --- ---  R.SSLVDGK.V
59   558.3316   1114.6486   1114.6630   -0.0144 0  51  0.0078 1  U   1.521 1.113 0.846  K.VTVSFFK.Q
122   676.8822   1351.7498   1351.7591   -0.0092 0  46  0.029 1  U   1.303 3.355 2.493  K.ASAAFEDLLK.V

23.   H2B_ACRFO    Mass: 16544    Score: 116    Matches: 4(2)  Sequences: 3(2)  emPAI: 0.50
 Histone H2B - Acropora formosa (Staghorn coral)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.442  2  1.034
         116/114  4.721  2  1.341
         117/114  9.121  2  1.313

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
95   621.3997   1240.7848   1240.7998   -0.0150 0  61  0.001 1  U   1.404 3.600 7.111  R.LLLPGELAK.H
140   719.3806   1436.7466   1436.7795   -0.0328 0  (12) 72 1  U   --- --- ---  K.ESYAIYIYK.V
141   719.3899   1436.7652   1436.7795   -0.0142 0  47  0.025 1  U   1.502 6.469 12.254  K.ESYAIYIYK.V
150   795.4304   1588.8462   1588.9018   -0.0556 1  8  1.9e+002 1  U   --- --- ---  K.ATISSREIQTAIR.L

24.   RS15A_DROME    Mass: 16629    Score: 112    Matches: 2(1)  Sequences: 2(1)  emPAI: 0.50
 40S ribosomal protein S15Aa - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.836  2  1.030
         116/114  1.010  2  1.093
         117/114  2.175  2  1.153

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
100   631.8629   1261.7112   1261.7308   -0.0195 0  38  0.21 1  U   0.817 0.941 2.401  R.MNVLADALK.C
171   785.3869   2353.1389   2353.1494   -0.0106 0  74  3.5e-005 1  U   0.866 1.118 1.822  R.QFGYVVLTTSGGIMDHEEAR.R

 
      Proteins matching the same set of peptides:
      RS15A_DROYA    Mass: 16629    Score: 112    Matches: 2(1)  Sequences: 2(1)
 40S ribosomal protein S15a - Drosophila yakuba (Fruit fly)
      RS15B_DROME    Mass: 16599    Score: 112    Matches: 2(1)  Sequences: 2(1)
 40S ribosomal protein S15Ab - Drosophila melanogaster (Fruit fly)

25.   PERC_DROME    Mass: 98282    Score: 110    Matches: 2(2)  Sequences: 2(2)  emPAI: 0.07
 Chorion peroxidase precursor (EC 1.11.1.7) (Peroxinectin-related protein) (Dpxt) [Contains: Chorion
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.265  2  1.008
         116/114  1.494  2  1.331
         117/114  1.102  2  1.689

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
94   613.3043   1224.5940   1224.5722   0.0218 0  47  0.023 1  U   1.260 1.253 0.756  K.ACPSEEAGK.S
185   833.7430   2498.2072   2498.2523   -0.0451 0  63  0.00036 1  U   1.279 2.169 2.068  R.VAGALHELNPSASDETLFQEAR.R

26.   RS2_DROME    Mass: 32524    Score: 102    Matches: 2(2)  Sequences: 2(2)  emPAI: 0.23
 40S ribosomal protein S2 (Protein strings of pearls) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.811  2  1.036
         116/114  0.782  2  1.112
         117/114  1.708  2  1.153

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
56   548.8428   1095.6710   1095.6532   0.0179 0  54  0.005 1  U   0.833 0.842 1.520  K.ATYAAIAK.T
121   670.8824   1339.7502   1339.7340   0.0163 0  50  0.013 1  U   0.776 0.684 2.010  R.GSTGTLGNFAK.A

27.   ATPA_DROME    Mass: 64900    Score: 101    Matches: 2(1)  Sequences: 2(1)  emPAI: 0.11
 ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) (Protein bellwether) - Drosophila
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  0.626  2  1.291
         116/114  1.496  2  1.769
         117/114  1.930  2  1.198

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
34   493.3436   984.6726   984.6575   0.0151 0  38  0.16 1  U   0.549 1.040 1.767  R.ILGVAPK.A
145   730.4130   1458.8114   1458.8286   -0.0171 0  63  0.00061 1      0.891 3.065 2.489  R.VVDALGNAIDGK.G

28.   GOSR1_DROME    Mass: 27079    Score: 98     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.13
 Probable 28 kDa Golgi SNARE protein (Golgi SNAP receptor complex member 1) - Drosophila melanogaste
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  ---  1  ---
         116/114  ---  1  ---
         117/114  ---  1  ---

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
15   476.8020   951.5894   951.5997   -0.0102 0  30  1.3 1  U   --- --- ---  K.LVAFSK.I
199   877.7497   2630.2273   2630.2914   -0.0641 0  68  8.7e-005 1  U   2.858 2.094 1.816  K.LSSLNESMSDLPASGAAAMHTLQR.H

29.   VIT2_DROME    Mass: 52892    Score: 95     Matches: 4(2)  Sequences: 2(1)  emPAI: 0.07
 Vitellogenin-2 precursor (Vitellogenin II) (Yolk protein 2) - Drosophila melanogaster (Fruit fly)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  1.358  2  1.051
         116/114  0.830  2  1.528
         117/114  1.482  2  1.018

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
6   439.2929   876.5712   876.5524   0.0188 0  28  3.1 1  U   --- --- ---  K.EVTLK.K
168   781.6876   2342.0410   2342.0719   -0.0310 0  67  8.2e-005 1  U   1.391 0.625 1.495  R.GDADFVDAIHTSAYGMGTSQR.L
169   781.6910   2342.0512   2342.0719   -0.0208 0  (46) 0.011 1  U   1.269 1.373 1.447  R.GDADFVDAIHTSAYGMGTSQR.L
170   781.7148   2342.1226   2342.0719   0.0506 0  (11) 56 1  U   --- --- ---  R.GDADFVDAIHTSAYGMGTSQR.L

30.   ATPA_HUMAN    Mass: 64273    Score: 79     Matches: 2(1)  Sequences: 2(1)  emPAI: 0.06
 ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) - Homo sapiens (Human)
Check to include this hit in error tolerant search or archive report
       
      Quantitation:  Ratio  Weighted  N  SD(geo)
         115/114  ---  1  ---
         116/114  ---  1  ---
         117/114  ---  1  ---

      Query  Observed  Mr(expt)  Mr(calc)   Delta Miss Score Expect Rank Unique 115/114 116/114 117/114  Peptide
14   474.7938   947.5730   947.5531   0.0199 0  16  45 1  U   --- --- ---  K.EGDIVK.R
 145   730.4130   1458.8114   1458.8286   -0.0171 0  63  0.00061 1      0.891 3.065 2.489  R.VVDALGNAIDGK.G

 
      Proteins matching the same set of peptides:
      ATPA_PONPY    Mass: 64303    Score: 79     Matches: 2(1)  Sequences: 2(1)
 ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) - Pongo pygmaeus (Orangutan)
      ATPA_RAT    Mass: 64420    Score: 79     Matches: 2(1)  Sequences: 2(1)
 ATP synthase subunit alpha, mitochondrial precursor (EC 3.6.3.14) - Rattus norvegicus (Rat)
      ATPA1_BOVIN    Mass: 64530    Score: 79     Matches: 2(1)  Sequences: 2(1)
 ATP synthase subunit alpha heart isoform, mitochondrial precursor (EC 3.6.3.14) - Bos taurus (Bovin
      ATPA2_BOVIN    Mass: 42114    Score: 79     Matches: 2(1)  Sequences: 2(1)
 ATP synthase subunit alpha liver isoform, mitochondrial precursor (EC 3.6.3.14) (Fragment) - Bos ta

Search Parameters

Type of search         : MS/MS Ion Search
Enzyme                 : Trypsin/P
Fixed modifications    : Methylthio (C),iTRAQ4plex (N-term),iTRAQ4plex (K)
Variable modifications : iTRAQ4plex (Y)
Mass values            : Monoisotopic
Protein Mass           : Unrestricted
Peptide Mass Tolerance : ± 0.2 Da (# 13C = 1)
Fragment Mass Tolerance: ± 0.2 Da
Max Missed Cleavages   : 2
Instrument type        : ESI-QUAD-TOF
Number of queries      : 234

Mascot:  http://www.matrixscience.com/

Top scoring peptide matches to query 1
denisef28QSTAR.402.3.1604.1604.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 37.08 to 37.08 min, Period: 1, Cycles(s): 1604 - 1604, Experiment 2 - 2
Score greater than 15 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 11.0        96   -0.0647                   AAIIK
 11.0        96   -0.0647                   AAILK
 11.0        96   -0.0647                   AALIK
 11.0        96   -0.0647                   AALLK
 11.0        96   -0.0647                   AIAIK
 11.0        96   -0.0647    1   APLP_DROME AIALK
 11.0        96   -0.0647                   ALAIK
 11.0        96   -0.0647                   ALALK
 11.0        96   -0.0284                   APSIK
 11.0        96   -0.0284                   APSLK
Top scoring peptide matches to query 2
denisef28QSTAR.402.3.1866.1866.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 68.38 to 68.38 min, Period: 1, Cycles(s): 1866 - 1866, Experiment 2 - 2
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 33.8       0.5    0.0335                   AIAIK
 33.8       0.5    0.0335    1   APLP_DROME AIALK
 33.8       0.5    0.0335                   ALAIK
 33.8       0.5    0.0335                   ALALK
 18.8        16    0.0335                   IAAIK
 18.8        16    0.0335                   IAALK
 18.8        16    0.0335                   LAAIK
 18.8        16    0.0335                   LAALK
 18.8        16    0.1184                   R.LAALQGS.-
 18.8        16    0.0698                   PSAIK
Top scoring peptide matches to query 3
denisef28QSTAR.415.3.2269.2269.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 116.39 to 116.39 min, Period: 1, Cycles(s): 2269 - 2269, Experiment 1 - 1
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 17.7        13    0.0128                   IAIPK
 17.7        13    0.0128                   IALPK
 17.7        13    0.0128                   LAIPK
 17.7        13    0.0128    1   APLP_DROME LALPK
 14.4        27    0.0501                   R.IAIVNR.A
 14.4        27    0.0501                   R.LAIVNR.D
 13.6        33    0.0128                   IAPIK
 13.6        33    0.0128                   IAPLK
 13.6        33    0.0128                   LAPIK
 13.6        33    0.0128                   LAPLK
Top scoring peptide matches to query 4
denisef28QSTAR.432.3.1773.1773.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 57.16 to 57.16 min, Period: 1, Cycles(s): 1773 - 1773, Experiment 1 - 1
Score greater than 22 indicates homology
Score greater than 46 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.2        90    0.0049                   IDTVK
 14.2        90    0.0049                   IESVK
 14.2        90    0.0049                   ISEVK
 14.2        90    0.0049                   ITDVK
 14.2        90    0.0049                   LDTVK
 14.2        90    0.0049                   LESVK
 14.2        90    0.0049                   LSEVK
 14.2        90    0.0049    6   TOP2_DROME LTDVK
 13.6    1e+002    0.0227                   K.PMTVK.S
  9.1  2.9e+002    0.0227                   LMSPK
Top scoring peptide matches to query 5
denisef28QSTAR.434.3.2218.2218.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 110.27 to 110.27 min, Period: 1, Cycles(s): 2218 - 2218, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 15.9        24    0.0085                  FIDGK
 15.9        24    0.0085    3   PDI_DROME FLDGK
 13.5        42    0.0336                  R.GGGFGGK.P
 10.9        75    1.0805                  R.DSGDGK.V
 10.2        90    0.0085                  IFDGK
 10.2        90    0.0085                  LFDGK
  9.9        96    1.0805                  K.SDDGGK.T
  9.9        96    1.0441                  TTDGGK
  9.5    1e+002    0.0085                  FGDIK
  9.5    1e+002    0.0085                  FGDLK
Top scoring peptide matches to query 6
denisef28QSTAR.439.3.1750.1750.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 54.52 to 54.52 min, Period: 1, Cycles(s): 1750 - 1750, Experiment 2 - 2
Score greater than 38 indicates homology
Score greater than 45 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 27.8       3.1    0.0188                   EVTIK
 27.8       3.1    0.0188   29   VIT2_DROME EVTLK
 23.6         8    1.0029                   K.AGVTLK.V
 23.6         8    1.0029                   K.QVTIK.I
 23.6         8    1.0029                   QVTLK
 13.7        78    0.0188                   DITIK
 13.7        78    0.0188                   DITLK
 13.7        78    0.0188                   DLTIK
 13.7        78    0.0188                   DLTLK
 13.7        78    0.0188                   IDTIK
Top scoring peptide matches to query 7
denisef28QSTAR.445.3.2460.2460.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 139.29 to 139.29 min, Period: 1, Cycles(s): 2460 - 2460, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.5        50    0.0323                   IDIIK
 14.5        50    0.0323                   IDILK
 14.5        50    0.0323                   IDLIK
 14.5        50    0.0323                   IDLLK
 14.5        50    0.0323                   LDIIK
 14.5        50    0.0323                   LDILK
 14.5        50    0.0323                   LDLIK
 14.5        50    0.0323    1   APLP_DROME LDLLK
 11.0  1.1e+002    0.1050                   IDEPK
 11.0  1.1e+002    0.1050                   IDPEK
Top scoring peptide matches to query 8
denisef28QSTAR.447.8.2202.2202.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 108.35 to 108.35 min, Period: 1, Cycles(s): 2202 - 2202, Experiment 1 - 1
Score greater than 41 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 42.0     0.079    0.0166    8   VDAC_DROME K.FAIGAK.Y
 25.8       3.3    0.0166                   R.FIAGAK.C
 25.8       3.3    0.0166                   R.FLAGAK.E
 25.7       3.4    0.0166                   FAIQK
 25.7       3.4    0.0166                   FALQK
 25.7       3.4    0.0166                   K.AFLGAK.G
 25.7       3.4    0.0497                   -.MSLGAK.P
 25.0         4    0.0166                   K.FAGIAK.A
 24.9       4.1    0.0166                   K.FAAVAK.K
 19.4        14    0.0166                   R.FAQIK.I
Top scoring peptide matches to query 9
denisef28QSTAR.448.3.2179.2179.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 105.6 to 105.6 min, Period: 1, Cycles(s): 2179 - 2179, Experiment 1 - 1
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 25.4         3    0.0184    5   EF11_DROME FAEIK
 25.4         3    0.0184                   FAELK
 12.3        64    0.0184                   K.FEAIK.K
 12.3        64    0.0184                   FEALK
 12.3        64   -0.0180                   K.FISIK.N
 12.3        64   -0.0180                   FISLK
 12.3        64   -0.0180                   FLSIK
 12.3        64   -0.0180                   FLSLK
 12.3        64   -0.0180                   FSIIK
 12.3        64   -0.0180                   FSILK
Top scoring peptide matches to query 10
denisef28QSTAR.448.8.2136.2136.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 100.44 to 100.44 min, Period: 1, Cycles(s): 2136 - 2136, Experiment 1 - 1
Score greater than 40 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 41.0     0.083    0.0146   10   YL_DROME K.CALGAK.C
 24.8       3.4   -0.0362                 K.GYLGAK.G
 24.5       3.7    0.0146                 K.CAIAGK.N
 24.5       3.7    0.0146                 R.CAIQK.A
 11.5        74    0.0001                 R.EFGGAK.G
 11.5        74   -0.0362                 R.FVSGAK.E
 11.5        74   -0.0362                 K.LYGGAK.S
 11.5        74    0.0332                 SMDGAK
 11.5        74   -0.0362                 K.VFSGAK.D
 11.5        74   -0.0475                 K.VHPGAK.I
Top scoring peptide matches to query 11
denisef28QSTAR.449.3.2236.2236.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 112.53 to 112.53 min, Period: 1, Cycles(s): 2236 - 2236, Experiment 2 - 2
Score greater than 35 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 25.2       2.7    0.0203    8   VDAC_DROME DIFSK
 25.2       2.7    0.0203                   DLFSK
 21.0       7.2    1.0044                   NIFSK
 21.0       7.2    1.0044                   NLFSK
 15.6        25    0.0204                   DIYAK
 15.6        25    0.0204                   DLYAK
 14.7        30    1.0044                   INFSK
 14.7        30    1.0044                   LNFSK
 12.4        52    0.0455                   NNFSK
 11.8        60    1.0044                   NLYAK
Top scoring peptide matches to query 12
denisef28QSTAR.451.8.1670.1670.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 44.86 to 44.86 min, Period: 1, Cycles(s): 1670 - 1670, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 19.5        11   -0.0014                   K.IPEGAK.E
 19.5        11   -0.0014    1   APLP_DROME LPEQK
 18.0        16    0.0359                   R.IQDLNR.I
 18.0        16    0.0359                   K.LQDLNR.Q
 16.0        25   -0.0014                   R.IEPGAK.V
 16.0        25   -0.0014                   K.IEPQK.E
 16.0        25   -0.0742                   IIIQK
 16.0        25   -0.0742                   IILAGK
 16.0        25   -0.0742                   IILQK
 16.0        25   -0.0742                   K.ILIAGK.N
Top scoring peptide matches to query 13
denisef28QSTAR.470.3.2366.2366.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 128.12 to 128.12 min, Period: 1, Cycles(s): 2366 - 2366, Experiment 2 - 2
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 25.3       3.3   -0.0276                   IIDYK
 25.3       3.3   -0.0276                   ILDYK
 25.3       3.3   -0.0276                   LIDYK
 25.3       3.3   -0.0276    1   APLP_DROME LLDYK
 15.3        33   -0.0276                   IDIYK
 15.3        33   -0.0276                   IDLYK
 15.3        33   -0.0276                   LDIYK
 15.3        33   -0.0276                   LDLYK
 13.6        48   -0.0276                   IIYDK
 13.6        48   -0.0276                   R.ILYDK.C
Top scoring peptide matches to query 14
denisef28QSTAR.474.8.1744.1744.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 53.7 to 53.7 min, Period: 1, Cycles(s): 1744 - 1744, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 45 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 15.6        45   -0.0165                   K.EALTVK.K
 15.6        45   -0.0165                   K.EATIVK.E
 15.6        45    0.0199                   K.EAVDVK.L
 15.6        45    0.0199                   EDGLVK
 15.6        45    0.0199                   R.EDVAVK.S
 15.6        45    0.0087                   EERVK
 15.6        45    0.0199                   EEVGVK
 15.6        45    0.0199   30   ATPA_HUMAN EGDIVK
 15.6        45    0.0199                   EGDLVK
 15.6        45    0.0199                   EGEVVK
Top scoring peptide matches to query 15
denisef28QSTAR.476.8.2385.2385.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 130.3 to 130.3 min, Period: 1, Cycles(s): 2385 - 2385, Experiment 1 - 1
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 29.6       1.3   -0.0102                    R.IGLFSK.P
 29.6       1.3   -0.0102                    K.IVAFSK.L
 29.6       1.3   -0.0102                    K.LGLFSK.E
 29.6       1.3   -0.0102                    K.LIGFSK.P
 29.6       1.3   -0.0102                    K.LLGFSK.M
 29.6       1.3   -0.0102   28   GOSR1_DROME K.LVAFSK.I
 25.1       3.8   -0.0215                    R.ILGPHK.L
 17.2        23    0.0625                    K.PDAFSK.V
 17.2        23   -0.0102                    K.VIAFSK.N
 17.1        24   -0.0102                    K.LVAAYK.N
Top scoring peptide matches to query 16
denisef28QSTAR.477.3.2200.2200.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 108.22 to 108.22 min, Period: 1, Cycles(s): 2200 - 2200, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 22.0         7    0.9952                   K.AGFIEK.V
 22.0         7    0.0111                   EFIEK
 22.0         7    0.0111   18   KPYK_DROME EFLEK
 22.0         7    0.9952                   GAFIEK
 22.0         7    0.9952                   QFIEK
 22.0         7    0.9952                   QFLEK
 13.7        47    1.0646                   R.AGEMEK.K
 13.7        47    1.0646                   K.GAEMEK.F
 13.7        47    1.0646                   QEMEK
 12.3        66    0.0806                   EEMEK
Top scoring peptide matches to query 17
denisef28QSTAR.477.8.2173.2173.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 104.88 to 104.88 min, Period: 1, Cycles(s): 2173 - 2173, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 17.4        19    0.0217    1   APLP_DROME K.FSDGLK.H
 17.4        19    0.0217                   FSDVAK
 15.8        28   -0.0147                   R.FTSALK.A
 11.2        79    0.0217                   R.FTSSPK.T
 10.4        95    0.0031                   R.FMAVAK.S
  9.0  1.3e+002    0.0217                   K.FDGLSK.S
  9.0  1.3e+002    0.0217                   K.FDLGSK.I
  9.0  1.3e+002    0.0217                   K.FXVASK.D
  9.0  1.3e+002    0.0105                   FERSK
  9.0  1.3e+002    0.0217                   R.FEVGSK.P
Top scoring peptide matches to query 18
denisef28QSTAR.479.8.2311.2311.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 121.42 to 121.42 min, Period: 1, Cycles(s): 2311 - 2311, Experiment 1 - 1
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 31.9      0.67   -0.0089    9   HSP7C_DROME K.DFFGGK.E
 19.1        13   -0.0089                    R.DFGFGK.R
 18.1        16   -0.0089                    DFFNK
 16.7        22    0.0055                    R.LCFGGK.S
 16.7        22   -0.0453                    K.VYFGGK.T
  9.5  1.1e+002    0.0241                    R.DYGMGK.Q
  9.1  1.3e+002    0.9751                    NFFNK
  7.8  1.7e+002   -0.0089                    DFNFK
  7.8  1.7e+002    0.0063                    K.DFSSSK.R
  7.8  1.7e+002    0.9751                    K.NFGFGK.L
Top scoring peptide matches to query 19
denisef28QSTAR.481.3.2104.2104.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 96.61 to 96.61 min, Period: 1, Cycles(s): 2104 - 2104, Experiment 1 - 1
Score greater than 37 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.3       3.5    0.0069   16   RL13_DROME LATQLK
 22.7       7.9    0.0433                   IANDIK
 22.7       7.9    0.0433                   IANDLK
 22.7       7.9    0.0069                   IAQTIK
 22.7       7.9    0.0069                   K.IAQTLK.D
 22.7       7.9    0.0069                   LAASALK
 22.7       7.9    0.0433                   LADNLK
 22.7       7.9    0.0069                   LAQTIK
 22.7       7.9    0.0069                   R.LAQTLK.Y
 17.1        29    0.1170                   K.IAGQGTDR.I
Top scoring peptide matches to query 20
denisef28QSTAR.481.8.2568.2568.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 152.28 to 152.28 min, Period: 1, Cycles(s): 2568 - 2568, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 45 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 22.9       8.2   -0.0345                   K.IISTIK.A
 22.9       8.2   -0.0345                   IISTLK
 22.9       8.2   -0.0345                   K.IITSIK.Y
 22.9       8.2   -0.0167                   K.ILGMLK.E
 22.9       8.2   -0.0167                   ILMGLK
 22.9       8.2   -0.0345                   R.ILSTIK.A
 22.9       8.2   -0.0345                   K.ILSTLK.E
 22.9       8.2   -0.0345                   K.ILTSLK.G
 22.9       8.2   -0.0345    1   APLP_DROME LISTLK
 22.9       8.2   -0.0345                   K.LITSLK.K
Top scoring peptide matches to query 21
denisef28QSTAR.483.8.2111.2111.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 97.45 to 97.45 min, Period: 1, Cycles(s): 2111 - 2111, Experiment 1 - 1
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 11.8        77    0.0115                  GYPTIK
 11.8        77    0.0115    3   PDI_DROME GYPTLK
  6.1  2.9e+002   -0.0249                  R.FLTGIK.P
  6.1  2.9e+002    0.0081                  -.MSVTLK.N
  5.2  3.5e+002    0.0479                  K.GYDPVK.W
  4.9  3.8e+002    0.0631                  K.SDDTLK.I
  4.5  4.2e+002    0.0366                  K.GGVFNGK.C
  4.4  4.3e+002    0.0623                  R.CATPLK.D
  4.3  4.4e+002   -0.0249                  R.AFVTLK.A
  3.9  4.8e+002    0.0445                  R.AMDTIK.I
Top scoring peptide matches to query 22
denisef28QSTAR.485.3.1910.1910.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 73.48 to 73.48 min, Period: 1, Cycles(s): 1910 - 1910, Experiment 1 - 1
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.1        48    0.0162    5   EF11_DROME YEEIK
 14.1        48    0.0162                   YEELK
 14.1        48    0.0050                   R.YSGGGLK.R
 12.4        71    0.1151                   SGGGYGGDR
  9.8  1.3e+002    0.0050                   K.YSANVK.Y
  8.2  1.8e+002    0.0050                   K.SNGYLK.K
  7.6  2.1e+002    0.0050                   YNASVK
  7.6  2.1e+002    0.0050                   R.YNTGVK.A
  7.2  2.3e+002    0.0050                   R.GNSYLK.K
  6.2    3e+002   -0.0678                   R.IPQPVK.T
Top scoring peptide matches to query 23
denisef28QSTAR.487.3.3255.3255.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 228.24 to 228.24 min, Period: 1, Cycles(s): 3255 - 3255, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 22.1       7.6   -0.0124    9   HSP7C_DROME FFPFK
 13.2        58   -0.0158                    R.FFMLK.F
 13.0        62    0.9644                    HRPFK
 13.0        62    0.9505                    K.PVPPFK.R
 13.0        62    0.9644                    K.RHPFK.H
 13.0        62    1.0740                    K.SCGPFK.V
 11.7        82    0.0392                    FEDFK
 11.4        88    0.0392                    FFDEK
  9.9  1.2e+002    0.0392                    FFEDK
  9.9  1.2e+002   -0.0124                    FFFPK
Top scoring peptide matches to query 24
denisef28QSTAR.487.3.3338.3338.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 238.25 to 238.25 min, Period: 1, Cycles(s): 3338 - 3338, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 26.7       2.6   -0.0064    9   HSP7C_DROME FFPFK
 17.5        22    0.9928                    K.FVGSFK.T
 17.5        22    0.9928                    K.FVSGFK.R
 16.3        28    0.0452                    FEDFK
 15.2        37    0.9704                    HRPFK
 15.2        37    0.9565                    K.PVPPFK.R
 15.2        37    0.9704                    K.RHPFK.H
 15.2        37    1.0800                    K.SCGPFK.V
 13.4        56    0.0266                    K.XYPFK.-
 13.2        58    0.0452                    FFDEK
Top scoring peptide matches to query 25
denisef28QSTAR.487.3.2948.2948.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 198.01 to 198.01 min, Period: 1, Cycles(s): 2948 - 2948, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 26.6       2.7   -0.0050    9   HSP7C_DROME FFPFK
 17.4        22   -0.0084                    R.FFMLK.F
 16.2        29    0.0466                    FEDFK
 15.4        35    0.9718                    HRPFK
 15.4        35    0.9579                    K.PVPPFK.R
 15.4        35    0.9718                    K.RHPFK.H
 15.4        35    1.0814                    K.SCGPFK.V
 13.2        59    0.0280                    K.XYPFK.-
 12.8        64    0.0466                    FFDEK
 12.8        64    0.0466                    FFEDK
Top scoring peptide matches to query 26
denisef28QSTAR.487.3.3162.3162.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 218.23 to 218.23 min, Period: 1, Cycles(s): 3162 - 3162, Experiment 2 - 2
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 20.9       9.8   -0.0020    9   HSP7C_DROME FFPFK
 18.6        17   -0.0054                    R.FFMLK.F
 13.6        53    0.0310                    K.XYPFK.-
 13.2        59   -0.0020                    FFFPK
 13.2        59   -0.0020                    R.FFFXK.K
 10.8    1e+002    0.9748                    HRPFK
 10.8    1e+002    0.9609                    K.PVPPFK.R
 10.8    1e+002    0.9748                    K.RHPFK.H
 10.8    1e+002    1.0844                    K.SCGPFK.V
 10.7  1.1e+002    0.0496                    FEDFK
Top scoring peptide matches to query 27
denisef28QSTAR.487.3.2865.2865.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 188 to 188 min, Period: 1, Cycles(s): 2865 - 2865, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 26.4       2.8   -0.0008    9   HSP7C_DROME FFPFK
 16.0        31    0.0508                    FEDFK
 15.1        38    0.9760                    HRPFK
 15.1        38    0.9621                    K.PVPPFK.R
 15.1        38    0.9760                    K.RHPFK.H
 15.1        38    1.0856                    K.SCGPFK.V
 13.1        60    0.0322                    K.XYPFK.-
 12.7        66    0.0508                    FFDEK
 12.7        66    0.0508                    FFEDK
 12.7        66   -0.0008                    FFFPK
Top scoring peptide matches to query 28
denisef28QSTAR.487.3.2697.2697.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 167.8 to 167.8 min, Period: 1, Cycles(s): 2697 - 2697, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 27.6       2.1    0.0004    9   HSP7C_DROME FFPFK
 17.4        22    0.9996                    K.FVGSFK.T
 17.4        22    0.9996                    K.FVSGFK.R
 17.2        23    0.0520                    FEDFK
 16.2        29    0.9772                    HRPFK
 16.2        29    0.9633                    K.PVPPFK.R
 16.2        29    0.9772                    K.RHPFK.H
 16.2        29    1.0868                    K.SCGPFK.V
 14.1        48    0.0334                    K.XYPFK.-
 14.0        49    0.0520                    FFDEK
Top scoring peptide matches to query 29
denisef28QSTAR.487.3.2781.2781.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 177.89 to 177.89 min, Period: 1, Cycles(s): 2781 - 2781, Experiment 1 - 1
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 23.9         5    0.0010    9   HSP7C_DROME FFPFK
 19.0        15   -0.0024                    R.FFMLK.F
 14.2        47    0.0526                    FEDFK
 13.4        56    0.9778                    HRPFK
 13.4        56    0.9639                    K.PVPPFK.R
 13.4        56    0.9778                    K.RHPFK.H
 13.4        56    1.0874                    K.SCGPFK.V
 12.0        78    0.0526                    FFDEK
 11.3        90    0.0340                    K.XYPFK.-
 11.3        91    0.0526                    FFEDK
Top scoring peptide matches to query 30
denisef28QSTAR.487.3.3046.3046.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 208.04 to 208.04 min, Period: 1, Cycles(s): 3046 - 3046, Experiment 1 - 1
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 26.8       2.6    0.0038    9   HSP7C_DROME FFPFK
 18.7        17    0.0004                    R.FFMLK.F
 16.4        28    0.0554                    FEDFK
 15.5        34    0.9806                    HRPFK
 15.5        34    0.9667                    K.PVPPFK.R
 15.5        34    0.9806                    K.RHPFK.H
 15.5        34    1.0902                    K.SCGPFK.V
 13.4        56    0.0554                    FFDEK
 13.4        56    0.0554                    FFEDK
 13.4        56    0.0038                    FFFPK
Top scoring peptide matches to query 31
denisef28QSTAR.488.3.2209.2209.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 109.3 to 109.3 min, Period: 1, Cycles(s): 2209 - 2209, Experiment 2 - 2
Score greater than 22 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.6  1.6e+002    0.0104                   YIYTK
  9.6  1.6e+002    0.0104    6   TOP2_DROME YLYTK
  8.7    2e+002   -0.0583                   IINVTK
  8.7    2e+002   -0.0583                   R.ILNVTK.A
  8.7    2e+002   -0.0583                   K.LLNVTK.M
  8.3  2.1e+002   -0.0219                   K.IINAEK.Q
  8.3  2.1e+002   -0.0219                   K.LINAEK.P
  7.7  2.4e+002    0.9135                   VAKPK
  7.7  2.4e+002    1.0097                   R.VDDLPK.L
  7.7  2.4e+002    1.0097                   K.VDEVPK.L
Top scoring peptide matches to query 32
denisef28QSTAR.488.3.2079.2079.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 93.62 to 93.62 min, Period: 1, Cycles(s): 2079 - 2079, Experiment 1 - 1
Score greater than 41 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 42.2     0.087    0.0058    9   HSP7C_DROME R.LIGDAAK.N
 26.1       3.5    0.0786                    K.EPGDAAK.A
 25.9       3.7    0.0058                    K.IPSTAAK.A
 25.9       3.7   -0.0054                    IREAAK
 25.9       3.7    0.0058                    R.IVDAAAK.I
 25.9       3.7    0.0058                    K.IVGEAAK.R
 25.9       3.7    0.0058                    LDVAAAK
 25.9       3.7    0.0058                    K.LGDLAAK.L
 25.9       3.7    0.0058                    LGVEAAK
 25.9       3.7   -0.0054                    LREAAK
Top scoring peptide matches to query 33
denisef28QSTAR.488.3.1994.1994.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 83.51 to 83.51 min, Period: 1, Cycles(s): 1994 - 1994, Experiment 1 - 1
Score greater than 41 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 42.6     0.079    0.0170    9   HSP7C_DROME R.LIGDAAK.N
 26.5       3.2    0.0898                    K.EPGDAAK.A
 26.3       3.4    0.0170                    K.IPSTAAK.A
 26.3       3.4    0.0058                    IREAAK
 26.3       3.4    0.0170                    R.IVDAAAK.I
 26.3       3.4    0.0170                    K.IVGEAAK.R
 26.3       3.4    0.0170                    LDVAAAK
 26.3       3.4    0.0170                    K.LGDLAAK.L
 26.3       3.4    0.0170                    LGVEAAK
 26.3       3.4    0.0058                    LREAAK
Top scoring peptide matches to query 34
denisef28QSTAR.493.3.2277.2277.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 117.35 to 117.35 min, Period: 1, Cycles(s): 2277 - 2277, Experiment 1 - 1
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 38.2      0.16    0.0151   27   ATPA_DROME R.ILGVAPK.A
 38.2      0.16    0.0039                   K.LIRAPK.D
 23.4       4.8    1.0607                   QPRAPK
 22.8       5.4    0.0151                   R.IINLPK.Y
 22.8       5.4    0.0151                   ILNIPK
 22.8       5.4    0.0151                   K.ILNLPK.I
 22.8       5.4    0.0151                   LIINPK
 22.8       5.4    0.0151                   R.LINIPK.K
 22.8       5.4    0.0151                   R.LIQVPK.G
 22.8       5.4    0.0151                   K.LLLNPK.L
Top scoring peptide matches to query 35
denisef28QSTAR.494.4.2490.2490.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 142.9 to 142.9 min, Period: 1, Cycles(s): 2490 - 2490, Experiment 1 - 1
Score greater than 30 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.9     0.062    0.1753    1   APLP_DROME K.LNLIVK.N
 28.7     0.083    0.1753                   R.IINIVK.A
 28.7     0.083    0.1753                   R.IINLVK.G
 28.7     0.083    0.1753                   R.LLNLVK.G
 17.3       1.1    0.1640                   R.IARIVK.A
 17.3       1.1    0.1753                   K.IQVIVK.D
 17.3       1.1    0.1640                   IRAIVK
 17.3       1.1    0.1640                   R.IRALVK.D
 17.3       1.1    0.1753                   IVQLVK
 17.3       1.1    0.1640                   R.LARIVK.L
Top scoring peptide matches to query 36
denisef28QSTAR.495.8.1974.1974.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 81.12 to 81.12 min, Period: 1, Cycles(s): 1974 - 1974, Experiment 1 - 1
Score greater than 25 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 19.2        18    0.0091    1   APLP_DROME K.NGLGTLK.I
 11.3  1.1e+002    0.0092                   K.NIGASLK.N
 11.3  1.1e+002    0.0092                   K.NLNTLK.T
 10.8  1.3e+002    0.0092                   K.NGISAIK.S
  9.2  1.8e+002   -0.0160                   ILDTIK
  9.2  1.8e+002   -0.0160                   K.ILDTLK.K
  9.2  1.8e+002   -0.0160                   LIDTIK
  9.2  1.8e+002   -0.0160                   LIDTLK
  9.2  1.8e+002   -0.0160                   K.LLDTIK.-
  9.2  1.8e+002   -0.0160                   LLDTLK
Top scoring peptide matches to query 37
denisef28QSTAR.495.8.2438.2438.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 136.76 to 136.76 min, Period: 1, Cycles(s): 2438 - 2438, Experiment 2 - 2
Score greater than 42 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 33.0      0.76    0.0214                   K.SIEIIK.F
 33.0      0.76    0.0214                   SIEILK
 33.0      0.76    0.0214                   SIELIK
 33.0      0.76    0.0214                   K.SIELLK.D
 33.0      0.76    0.0214    1   APLP_DROME SLELLK
 27.8       2.5    0.0466                   SIQNLK
 27.8       2.5    0.0466                   K.SLGANIK.V
 24.8       4.9    0.0951                   K.SLEATLGR.L
 22.0       9.5    0.0942                   K.SIEPEK.F
 22.0       9.5    0.0942                   K.SLEPEK.D
Top scoring peptide matches to query 38
denisef28QSTAR.496.3.1739.1739.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 53.1 to 53.1 min, Period: 1, Cycles(s): 1739 - 1739, Experiment 1 - 1
Score greater than 42 indicates homology
Score greater than 45 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 42.8     0.085    0.0077                    R.INETVK.E
 42.8     0.085    0.0077   11   SPTCA_DROME LNETVK
 26.8       3.4   -0.0035                    K.RAETVK.R
 26.8       3.4    0.0077                    K.VQETVK.Q
 26.8       3.4    0.0077                    K.IADGTVK.R
 26.8       3.4    0.0077                    R.IENTVK.K
 26.8       3.4   -0.0075                    K.IGWTVK.P
 26.8       3.4    0.0077                    K.IQDTVK.S
 26.8       3.4   -0.0399                    K.IRSTVK.I
 26.8       3.4    0.0077                    LENTVK
Top scoring peptide matches to query 39
denisef28QSTAR.497.3.1696.1696.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 48.06 to 48.06 min, Period: 1, Cycles(s): 1696 - 1696, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.6       3.1    0.0164   22   FAS1_DROME R.SSLVDGK.V
 22.7       7.5    1.0368                   K.ATNVDGK.E
 17.5        25   -0.0199                   R.SSILTGK.Y
 13.2        67    0.0528                   K.ADISDGK.T
 13.2        67    0.0892                   K.AEADDGK.K
 13.2        67    0.0892                   R.AGEEDGK.D
 13.2        67    1.0368                   K.AGGSLDGK.P
 13.2        67    0.0164                   K.ATLTDGK.Y
 13.2        67    0.0780                   K.DRDDGK.A
 13.2        67    0.0892                   R.EDAADGK.F
Top scoring peptide matches to query 40
denisef28QSTAR.497.8.1575.1575.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 33.51 to 33.51 min, Period: 1, Cycles(s): 1575 - 1575, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 22.4       6.9    0.0122                    R.ISDDEK.L
 22.4       6.9   -0.0064                    K.LMADEK.M
 22.4       6.9    0.0122    9   HSP7C_DROME LSDDEK
 22.4       6.9   -0.0242                    K.LTTDEK.F
 21.0       9.5   -0.0758                    K.IAVFEK.M
 21.0       9.5   -0.0241                    R.IETSEK.K
 21.0       9.5   -0.0758                    R.IFGLEK.S
 21.0       9.5   -0.0758                    K.IFIGEK.Q
 21.0       9.5   -0.0758                    R.IFLGEK.D
 21.0       9.5   -0.0758                    K.IGFIEK.L
Top scoring peptide matches to query 41
denisef28QSTAR.501.8.2238.2238.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 112.77 to 112.77 min, Period: 1, Cycles(s): 2238 - 2238, Experiment 2 - 2
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 36.0      0.29    0.0061                  R.QGVIGIK.V
 36.0      0.29    0.0061   14   RS3_DROME R.QGVLGIK.V
 36.0      0.29    0.0061                  R.QGVLGLK.V
 21.7       7.8   -0.0051                  R.AGRLIGK.K
 21.7       7.8   -0.0051                  M.AGRLLGK.A
 21.7       7.8    0.0061                  R.AGVGIGIK.K
 21.7       7.8   -0.0051                  K.QRLLGK.V
 21.7       7.8   -0.0051                  QRLVAK
 21.4       8.4    0.0061                  R.GQVLLGK.N
 21.4       8.4    0.0062                  R.NAVIVAK.S
Top scoring peptide matches to query 42
denisef28QSTAR.504.3.1756.1756.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 55.13 to 55.13 min, Period: 1, Cycles(s): 1756 - 1756, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 15.0        46    0.0118    1   APLP_DROME R.GLSVSEK.F
 10.3  1.4e+002    0.0118                   K.AVSSEVK.F
  8.1  2.3e+002    0.0482                   GIGTDEK
  8.1  2.3e+002    0.0482                   R.GLGTDEK.T
  7.8  2.4e+002    0.0846                   K.GIGDDDK.V
  7.5  2.6e+002    0.0482                   M.GLEGSEK.L
  7.1  2.8e+002    0.0329                   R.GLSWEK.T
  7.0  2.9e+002    0.0118                   K.GLATTEK.L
  6.3  3.4e+002    0.0370                   K.GLSNSNK.F
  6.3  3.4e+002    0.0296                   K.AAMAVEK.L
Top scoring peptide matches to query 43
denisef28QSTAR.505.3.2423.2423.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 134.85 to 134.85 min, Period: 1, Cycles(s): 2423 - 2423, Experiment 1 - 1
Score greater than 35 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 23.7       4.8   -0.0165    3   PDI_DROME K.IFGGSIK.S
 21.0       8.9   -0.0165                  IFNSIK
 21.0       8.9   -0.0165                  K.IFSNIK.G
 21.0       8.9   -0.0165                  R.LFNSIK.P
 21.0       8.9   -0.0165                  LFNSLK
 21.0       8.9   -0.0165                  K.LFSNIK.I
 21.0       8.9   -0.0165                  R.LFSNLK.D
  9.3  1.3e+002   -0.0165                  K.LFGLGSK.T
  9.1  1.4e+002   -0.0165                  K.IFLSNK.-
  9.1  1.4e+002   -0.0165                  R.LFLSNK.G
Top scoring peptide matches to query 44
denisef28QSTAR.506.3.1694.1694.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 47.82 to 47.82 min, Period: 1, Cycles(s): 1694 - 1694, Experiment 2 - 2
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 29.6       1.2    0.0168   10   YL_DROME R.AVVYGSK.E
 14.7        38   -0.0186                 K.AVIIGAPAR.H
 14.7        38    0.0429                 R.AVVSQHAR.Q
  8.9  1.4e+002    0.0532                 K.AVKYXD.-
  7.6  1.9e+002    0.0676                 K.AVCASVK.D
  5.5  3.2e+002    0.0532                 K.AVNEYK.E
  4.6  3.9e+002    0.0564                 K.AVCTRK.Y
  4.6  3.9e+002    0.1196                 K.AVDEFMR.L
  4.6  3.9e+002    0.0542                 K.AVDGGVPPR.S
  4.6  3.9e+002    0.1308                 R.AVEMAAEF.-
Top scoring peptide matches to query 45
denisef28QSTAR.510.8.2448.2448.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 137.96 to 137.96 min, Period: 1, Cycles(s): 2448 - 2448, Experiment 2 - 2
Score greater than 23 indicates homology
Score greater than 45 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 20.8        13    0.0307   11   SPTCA_DROME FQYFK
  9.0    2e+002    1.0088                    R.DIEVQK.M
  9.0    2e+002    1.0088                    K.DILDQK.I
  9.0    2e+002    1.0088                    DIVEQK
  9.0    2e+002    1.0088                    K.DLDLQK.G
  9.0    2e+002    1.0088                    K.EVIDQK.L
  9.0    2e+002    1.0088                    K.EVVEQK.F
  9.0    2e+002    1.0088                    IDDIQK
  9.0    2e+002    1.0088                    K.LDDIQK.D
  9.0    2e+002    1.0340                    K.NNLDQK.L
Top scoring peptide matches to query 46
denisef28QSTAR.512.8.2139.2139.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 100.9 to 100.9 min, Period: 1, Cycles(s): 2139 - 2139, Experiment 2 - 2
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 33.7      0.47    0.0196    1   APLP_DROME K.ALSGNFK.L
 24.0       4.4    0.0196                   K.ALSGFNK.V
 14.0        44    0.0308                   AIEEFK
 14.0        44    0.0308                   ALEEFK
 14.0        44    0.0308                   R.IAEEFK.N
 14.0        44    0.0308                   LAEEFK
 12.6        61    0.0196                   R.TAVGNFK.L
 12.6        61    0.0196                   R.TLGGNFK.V
  6.6  2.4e+002   -0.0055                   R.IAYEIK.D
  6.6  2.4e+002   -0.0055                   LAYEIK
Top scoring peptide matches to query 47
denisef28QSTAR.513.3.3182.3182.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 220.02 to 220.02 min, Period: 1, Cycles(s): 3182 - 3182, Experiment 1 - 1
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.0  1.4e+002    0.9928                   AIEEFK
  9.0  1.4e+002    0.9928                   ALEEFK
  9.0  1.4e+002   -0.0388                   K.ALSATFK.E
  9.0  1.4e+002    0.9816    1   APLP_DROME K.ALSGNFK.L
  5.9  2.8e+002    0.9928                   AEELFK
  5.9  2.8e+002    0.9816                   K.AGNSLFK.S
  5.6  3.1e+002    0.9928                   R.IAEEFK.N
  5.6  3.1e+002    0.9928                   LAEEFK
  5.6  3.1e+002   -0.0210                   R.LAQMFK.E
  5.0  3.4e+002    0.9704                   R.SGAARFK.G
Top scoring peptide matches to query 48
denisef28QSTAR.514.8.2916.2916.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 194.15 to 194.15 min, Period: 1, Cycles(s): 2916 - 2916, Experiment 1 - 1
Score greater than 26 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 24.6       3.2    0.0010                   R.FDAFLK.K
 24.6       3.2    0.0010                   R.FEGFIK.T
 24.6       3.2   -0.0142    4   UGGG_DROME FWFLK
 12.1        56    0.0154                   FCALLK
 11.7        62   -0.0353                   K.AVYFLK.S
 11.7        62   -0.0353                   R.AYVFLK.K
 11.7        62    0.0010                   DFAFIK
 11.7        62    0.0010                   R.EGFFLK.S
 11.7        62    0.0010                   K.GEFFIK.D
 11.7        62   -0.0353                   K.GYLFLK.I
Top scoring peptide matches to query 49
denisef28QSTAR.518.8.2585.2585.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 154.32 to 154.32 min, Period: 1, Cycles(s): 2585 - 2585, Experiment 1 - 1
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 23.7       6.3   -0.0087    1   APLP_DROME R.IVYILK.G
 23.7       6.3   -0.0087                   K.IVYLLK.H
 23.7       6.3   -0.0087                   K.LVYILK.T
 23.7       6.3   -0.0087                   K.LVXLLK.F
 16.9        30   -0.0087                   R.IVIYIK.Y
 16.9        30   -0.0087                   K.IVLYIK.E
 16.9        30   -0.0087                   K.IXLYIK.E
 16.9        30   -0.0087                   K.LVLYIK.L
 16.9        30   -0.0087                   K.LVLYLK.N
 13.0        75    0.0277                   K.IVEFIK.F
Top scoring peptide matches to query 50
denisef28QSTAR.524.3.2598.2598.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 155.89 to 155.89 min, Period: 1, Cycles(s): 2598 - 2598, Experiment 1 - 1
Score greater than 42 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 42.7     0.082   -0.0055                   K.TIIVEGK.G
 42.7     0.082   -0.0055                   K.TIIVGEK.D
 42.7     0.082   -0.0207   13   GBLP_DROME K.TLIVWK.L
 27.3       2.9   -0.0055                   K.DVLVSVK.N
 27.3       2.9   -0.0055                   K.VDIVSVK.E
 26.9       3.2    0.0309                   R.TLPDVSK.I
 26.9       3.2   -0.0055                   K.TLVIEGK.S
 26.9       3.2   -0.0207                   K.TLVLWK.D
 26.5       3.5   -0.0419                   TIIATIK
 26.5       3.5   -0.0055                   M.TIIIDGK.K
Top scoring peptide matches to query 51
denisef28QSTAR.527.8.2112.2112.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 97.56 to 97.56 min, Period: 1, Cycles(s): 2112 - 2112, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 24.2       4.3    0.0262   18   KPYK_DROME K.SAFQVSK.Y
 12.7        62    1.0102                   K.RFEVSK.A
 12.6        62    0.0474                   R.SFAQWK.P
 12.3        67    1.0466                   K.RFEEGK.G
 10.1  1.1e+002    0.0779                   R.SSTGEASK.G
  7.0  2.2e+002    0.0262                   R.AYAVGASK.D
  7.0  2.3e+002    0.1142                   R.ADSDSGSK.R
  7.0  2.3e+002    0.0262                   K.AIQYGSK.A
  7.0  2.3e+002    0.0956                   K.GMSAEGSK.F
  7.0  2.3e+002    0.0804                   -.MSWAGSK.R
Top scoring peptide matches to query 52
denisef28QSTAR.530.3.2496.2496.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 143.62 to 143.62 min, Period: 1, Cycles(s): 2496 - 2496, Experiment 1 - 1
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.4       2.6   -0.0129    4   UGGG_DROME R.IVPEWK.D
 23.4       5.2   -0.0705                   K.LVIIDAK.G
 22.2       6.9   -0.1069                   K.IVSIVLK.T
 22.2       6.9   -0.0341                   K.LVSEVPK.H
 22.2       6.9   -0.0341                   K.LVSLDPK.Q
 22.2       6.9   -0.0705                   K.IVDLLAK.D
 22.2       6.9    0.0023                   LVDEAPK
 14.9        37   -0.0219                   R.IVSLASNVL.-
 13.6        50    0.0023                   K.VLPEEGK.G
 12.7        62   -0.0089                   R.LVPNSNK.A
Top scoring peptide matches to query 53
denisef28QSTAR.534.3.2304.2304.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 120.59 to 120.59 min, Period: 1, Cycles(s): 2304 - 2304, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 24.3       4.6    0.0118   12   ATPB_DROME K.ILQDYK.S
 15.0        38   -0.0068                   R.ILQMFK.D
 13.9        49    0.0118                   K.IIDQYK.Q
 13.9        49   -0.0358                   K.IISRYK.E
 13.9        49   -0.0034                   R.IIWGYK.I
 13.9        49    0.0118                   ILENYK
 13.9        49    0.0118                   R.ILNEYK.K
 13.9        49   -0.0358                   R.ILRSYK.N
 13.9        49   -0.0246                   K.ILSGVYK.K
 13.9        49    0.0118                   K.LIDAGYK.I
Top scoring peptide matches to query 54
denisef28QSTAR.534.8.1678.1678.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 45.91 to 45.91 min, Period: 1, Cycles(s): 1678 - 1678, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 37.5       0.2   -0.0103    2   VIT3_DROME K.EQDGFGK.R
 12.9        59   -0.0103                   K.EQNFDK.Q
 12.8        59   -0.0103                   K.GAENFDK.F
 12.4        66   -0.0579                   R.DRTGFGK.F
 11.6        79   -0.0691                   K.RNHPEK.L
 10.2  1.1e+002    0.0042                   K.EAGNCIK.I
 10.1  1.1e+002    0.0042                   K.QENMMK.Y
 10.1  1.1e+002   -0.0255                   K.EHYFGK.E
  9.8  1.2e+002   -0.0579                   K.TRDFNK.I
  8.7  1.5e+002   -0.0093                   K.RTDDYVR.G
Top scoring peptide matches to query 55
denisef28QSTAR.542.8.1571.1571.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 33.09 to 33.09 min, Period: 1, Cycles(s): 1571 - 1571, Experiment 1 - 1
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 20.7       9.3    0.0136    5   EF11_DROME GYVAGDSK
  9.5  1.2e+002    0.0348                   R.GYAWDGK.S
  9.4  1.2e+002    0.0136                   K.GYVGEGSK.E
  7.2  2.1e+002    0.0500                   K.DGFQDSK.S
  7.2  2.1e+002    0.0644                   LCGGEGSK
  7.2  2.1e+002   -0.0010                   R.MSTRSSK.A
  7.2  2.1e+002    0.0024                   R.RYNESK.K
  7.2  2.1e+002   -0.0452                   R.YRRSSK.S
  6.0  2.7e+002    0.0580                   K.TMSALLCR.P
  5.7    3e+002    0.0398                   R.FSRSSNSR.P
Top scoring peptide matches to query 56
denisef28QSTAR.548.8.2133.2133.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 100.08 to 100.08 min, Period: 1, Cycles(s): 2133 - 2133, Experiment 1 - 1
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 53.7     0.005    0.0179   26   RS2_DROME K.ATYAAIAK.T
 23.5       5.1    0.0179                  M.ATSAAFLK.G
 19.3        13    0.0390                  K.AGYWIAK.V
 19.3        13    0.0390                  K.AGYWLAK.V
 19.3        13    0.0067                  K.AYRSIAK.A
 19.3        13    0.0067                  K.AYRSLAK.K
 17.7        20    0.0543                  R.ATNDFIK.L
 17.7        20    0.0179                  K.ATQTIFK.E
 17.3        22    0.0066                  R.ATYGRLK.V
 17.3        22    0.0543                  K.ATYPATGK.S
Top scoring peptide matches to query 57
denisef28QSTAR.554.8.2077.2077.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 93.38 to 93.38 min, Period: 1, Cycles(s): 2077 - 2077, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.6        50    0.0136    1   APLP_DROME R.VAFNANGK.L
 10.2  1.4e+002   -0.0115                   K.VAFDLAGK.R
 10.0  1.4e+002   -0.0115                   R.AVFDGLAK.A
  9.4  1.6e+002    0.0062                   K.MWLAATK.K
  6.7    3e+002    1.0241                   M.ASEITNGK.N
  6.5  3.2e+002    0.9643                   K.ASKANGK.E
  6.4  3.3e+002   -0.0115                   R.AFVDAVAK.A
  5.5    4e+002   -0.0197                   R.KETNGK.L
  5.5    4e+002    0.0249                   K.PGYALDGK.S
  5.2  4.3e+002   -0.0115                   K.VAFLNEK.R
Top scoring peptide matches to query 58
denisef28QSTAR.557.3.2218.2218.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 110.38 to 110.38 min, Period: 1, Cycles(s): 2218 - 2218, Experiment 2 - 2
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 39.8      0.11    0.0142    5   EF11_DROME K.EVSSYIK.K
 39.8      0.11    0.0142                   EVSSYLK
 24.7       3.6    0.0393                   K.GGNSSYIK.I
 24.7       3.6    0.0142                   K.IDSSYLK.V
 24.7       3.6    0.0142                   K.LDSSYLK.L
 24.4       3.9    0.0142                   K.EVSSLYK.Q
 21.7       7.3   -0.0335                   R.EVHSLIK.P
 21.6       7.5   -0.0335                   R.DISLHIK.S
 21.6       7.5   -0.0335                   K.DLSHILK.K
 21.6       7.5   -0.0335                   K.DLSHLLK.C
Top scoring peptide matches to query 59
denisef28QSTAR.558.3.2607.2607.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 156.97 to 156.97 min, Period: 1, Cycles(s): 2607 - 2607, Experiment 1 - 1
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 51.4    0.0078   -0.0144   22   FAS1_DROME K.VTVSFFK.Q
 20.2        10    0.0220                   K.EASVFFK.K
 17.6        19   -0.0256                   K.VVTHPFK.T
  8.9  1.4e+002   -0.0144                   K.VISFYAK.K
  8.6  1.5e+002    0.0260                   K.VTDDHLK.G
  8.6  1.5e+002    0.0220                   K.VTEFFGK.E
  8.6  1.5e+002   -0.0580                   K.VTGGRIPK.E
  8.6  1.5e+002   -0.0467                   K.VTGIPAAAK.-
  8.6  1.5e+002   -0.0580                   R.VTGPRGIK.K
  8.6  1.5e+002   -0.0467                   R.VTPNIGVK.T
Top scoring peptide matches to query 60
denisef28QSTAR.559.4.2274.2274.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 117.09 to 117.09 min, Period: 1, Cycles(s): 2274 - 2274, Experiment 2 - 2
Score greater than 43 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 43.9     0.056    0.0216   11   SPTCA_DROME K.ALAALDQK.I
 27.4       2.5    0.0216                    R.AIAGLEAGK.Y
 27.4       2.5    0.0216                    K.ALAEVAQK.L
 24.9       4.5    0.0104                    K.AIAAAREK.G
 22.3       8.1   -0.0148                    ALAAVLSGK
 18.7        18   -0.0260                    R.ALARALSK.E
 14.8        46    0.0216                    K.AAIIDAGAK.V
 14.8        46    0.0216                    K.AALEAVQK.A
 14.8        46    0.0831                    R.ASPGAGGGGAK.A
 14.6        48    0.0216                    K.AIELQQK.E
Top scoring peptide matches to query 61
denisef28QSTAR.562.2.2528.2528.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 147.57 to 147.57 min, Period: 1, Cycles(s): 2528 - 2528, Experiment 2 - 2
Score greater than 31 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 30.3      0.56   -0.0101   21   LAMC1_DROME K.NCEFCK.Y
 16.8        13   -0.0101                    K.GGCFECK.E
 13.9        25    0.8979                    R.YVEFCK.S
  6.6  1.3e+002   -0.1548                    K.LESIPCK.D
  6.6  1.3e+002   -0.1548                    K.LESLPCK.I
  6.6  1.3e+002   -0.1548                    K.LLDTPCK.P
  6.5  1.4e+002   -0.1661                    K.NGGVLVCK.P
  6.2  1.5e+002   -0.1660                    K.NIQALCK.Q
  5.3  1.8e+002   -0.1660                    R.NCLQALK.E
  4.3  2.3e+002    0.8292                    K.LLQSPCK.E
Top scoring peptide matches to query 62
denisef28QSTAR.562.3.2147.2147.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 101.76 to 101.76 min, Period: 1, Cycles(s): 2147 - 2147, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 37.1      0.25    0.0344    3   PDI_DROME K.LEEDMAK.Y
 15.7        34    0.0344                  K.LEEAMDK.I
 14.9        40    0.0751                  K.IEEDNFGR.T
 11.7        85   -0.0350                  K.IEELFGK.Q
 11.7        85   -0.0350                  R.IEELGFK.P
 11.7        85   -0.0350                  LEEGLFK
 11.7        85   -0.0350                  R.LEEIGFK.L
 11.7        85   -0.0350                  R.LEELGFK.F
 11.7        85    0.0192                  K.LEEMWK.E
 10.4  1.1e+002   -0.0575                  R.IGVGHPGAK.E
Top scoring peptide matches to query 63
denisef28QSTAR.562.8.2499.2499.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 143.98 to 143.98 min, Period: 1, Cycles(s): 2499 - 2499, Experiment 1 - 1
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 27.3       2.2   -0.0108    1   APLP_DROME K.NIDFSLK.A
 24.6       4.2    0.0256                   K.INDEFAK.S
 24.6       4.2   -0.0109                   K.INDVFTK.E
 17.0        24   -0.0108                   R.NLFDSIK.S
 16.2        28   -0.0472                   K.NLYVSIK.G
 15.4        34   -0.0221                   M.ARDFSLK.N
 14.4        44   -0.0221                   R.NIHEPVK.T
 14.1        46    0.9480                   K.LLDFSIK.V
 13.3        56   -0.0472                   K.INVYSLK.G
 12.2        72    0.0256                   R.NIDAFEK.R
Top scoring peptide matches to query 64
denisef28QSTAR.563.3.2454.2454.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 138.57 to 138.57 min, Period: 1, Cycles(s): 2454 - 2454, Experiment 1 - 1
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 35.2      0.34    0.0241    3   PDI_DROME R.TLDDFVK.F
 21.0       8.9   -0.0123                  R.TLTEFVK.S
 19.3        13    0.0241                  DTIDFVK
 19.3        13    0.0241                  K.EISDFVK.K
 19.3        13   -0.0357                  KGDFVK
 19.3        13    0.0493                  K.QSNDFVK.L
 15.9        29    1.0445                  K.EAGADFVK.T
 15.9        29    1.0081                  NTLDFVK
 15.9        29    1.0081                  R.QSLDFVK.I
 15.8        29    0.9969                  R.GRTEFVK.D
Top scoring peptide matches to query 65
denisef28QSTAR.565.3.1845.1845.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 65.87 to 65.87 min, Period: 1, Cycles(s): 1845 - 1845, Experiment 2 - 2
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 21.8       7.4    0.0120    1   APLP_DROME R.SDSLEYK.N
 10.5        98    0.0120                   K.DSLESYK.P
 10.5        98   -0.0066                   -.MAEVTYK.G
  8.8  1.5e+002   -0.0066                   R.TGLMEYK.A
  8.8  1.5e+002   -0.0244                   K.TSTLEYK.P
  6.7  2.4e+002   -0.1084                   R.PIVSAVQK.R
  6.7  2.4e+002   -0.1084                   R.VPLASVQK.V
  6.1  2.7e+002    0.0372                   R.SGSGNEYK.W
  4.5  3.9e+002   -0.0145                   R.AFAQNYK.E
  4.5  3.9e+002   -0.0760                   R.AIALYYK.D
Top scoring peptide matches to query 66
denisef28QSTAR.569.8.2506.2506.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 144.82 to 144.82 min, Period: 1, Cycles(s): 2506 - 2506, Experiment 1 - 1
Score greater than 43 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 57.1    0.0024   -0.0033    1   APLP_DROME K.ACDIALAK.V
 26.9       2.4   -0.1381                   K.HVVLAIAK.N
 26.9       2.4   -0.0905                   R.ATYALLAK.Q
 22.9       6.1   -0.0033                   K.ACEVLAAK.E
 14.9        38   -0.0177                   K.ADFDAAIK.A
 14.2        46   -0.0541                   K.STFPSLAK.I
 13.5        53   -0.0541                   K.YGDIVGVK.Y
 13.2        58   -0.0330                   K.DWFALAK.Q
 13.2        58   -0.0905                   K.YLATALAK.W
 13.1        59   -0.0289                   K.AGGYGNLAK.F
Top scoring peptide matches to query 67
denisef28QSTAR.569.8.2070.2070.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 92.54 to 92.54 min, Period: 1, Cycles(s): 2070 - 2070, Experiment 1 - 1
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 31.2      0.91    0.0203    1   APLP_DROME K.EAGPDFSK.L
 21.2       9.2    0.0421                   K.EQMGNGSK.G
 17.4        22   -0.0606                   K.EQSKSK.K
 11.3        88   -0.0970                   M.TVGKSSK.M
 11.1        92   -0.0637                   K.ENHIIPK.L
 10.2  1.2e+002   -0.0889                   R.LGSLVFSK.A
 10.2  1.2e+002   -0.0678                   K.WAVLFSK.L
  9.7  1.3e+002   -0.0525                   K.ELINFSK.R
  9.5  1.4e+002    0.0576                   M.AEGDYNAVR.E
  9.4  1.4e+002    0.0355                   K.EATADESK.A
Top scoring peptide matches to query 68
denisef28QSTAR.571.3.1748.1748.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 54.17 to 54.17 min, Period: 1, Cycles(s): 1748 - 1748, Experiment 1 - 1
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 21.2       7.9   -0.0004    1   APLP_DROME K.SSTFVANK.K
 11.0        84   -0.0116                   K.SLHGGASPK.C
  7.4  1.9e+002    0.9360                   R.VRAPPQGK.K
  5.3  3.1e+002    0.0360                   K.SADTFNAK.V
  5.2  3.2e+002    0.9612                   K.GRIHGNAK.G
  5.0  3.3e+002    0.0326                   R.SMLSSSNK.R
  4.8  3.5e+002    0.9762                   K.MLIYANK.I
  3.7  4.5e+002    1.0643                   K.METESGAK.I
  3.3  4.9e+002   -0.0116                   R.SIGSGHPAK.R
  3.2    5e+002   -0.0480                   K.NTVHALAK.F
Top scoring peptide matches to query 69
denisef28QSTAR.571.3.2258.2258.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 115.07 to 115.07 min, Period: 1, Cycles(s): 2258 - 2258, Experiment 1 - 1
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 27.4       1.9    0.0230    6   TOP2_DROME K.FINNMSK.S
 20.0        10   -0.0798                   K.FISKSK.S
 17.3        19   -0.0352                   FIGELFK
 16.9        21    0.0156                   K.FLCPLSK.Y
 16.9        21   -0.0798                   FLKSSK
 16.9        21    0.0156                   K.FLPCLSK.E
 15.8        28   -0.0101                   R.FINNFAK.Y
 11.2        80    0.0342                   K.EMLDAFK.A
  9.5  1.2e+002   -0.0101                   R.FINFQGK.I
  9.0  1.3e+002   -0.0352                   R.LFYVSPK.S
Top scoring peptide matches to query 70
denisef28QSTAR.575.8.2141.2141.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 101.04 to 101.04 min, Period: 1, Cycles(s): 2141 - 2141, Experiment 1 - 1
Score greater than 41 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 39.8      0.14    0.0087    3   PDI_DROME ALAPEYAK
 26.2       3.2    0.0087                  K.AALPEYAK.D
 24.5       4.8    0.0604                  R.AIADDTEK.L
 14.7        46   -0.0722                  K.AIASKTK.E
 14.7        46   -0.0025                  ALAAQFNK
 14.7        46    0.0305                  K.ALANNMTK.D
 14.7        46    0.0053                  K.ALATDLMK.I
 13.7        57    0.0087                  R.SPAPYLSK.S
 11.7        90   -0.0099                  K.ALWTMLK.L
 10.8  1.1e+002   -0.0025                  R.AIAAYTPR.E
Top scoring peptide matches to query 71
denisef28QSTAR.579.8.2313.2313.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 121.77 to 121.77 min, Period: 1, Cycles(s): 2313 - 2313, Experiment 2 - 2
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 31.8      0.71   -0.0611    5   EF11_DROME K.QLIVGVNK.M
 18.2        16   -0.0247                   K.QITLPGNK.I
 15.0        34   -0.0036                   K.QIFTHPK.D
 14.8        35    0.0844                   K.QEEEAHK.L
 12.7        57    0.0076                   K.AGIFFSTK.Q
 12.7        57    0.0584                   R.QIFCSVK.P
 12.7        57    0.0440                   R.QIFGDYK.T
 12.7        57    0.0440                   R.QIFYDGK.P
 11.2        81   -0.1097                   QLLKPK
  9.8  1.1e+002    0.0004                   R.QDKLNPR.R
Top scoring peptide matches to query 72
denisef28QSTAR.579.9.2295.2295.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 119.51 to 119.51 min, Period: 1, Cycles(s): 2295 - 2295, Experiment 1 - 1
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 40.4     0.096    0.0001    5   EF11_DROME K.QLIVGVNK.M
 22.5       5.9   -0.0485                   QLLKPK
 21.7         7    0.0616                   R.QDKLNPR.R
 15.6        29    0.0365                   K.LQLTPGNK.E
 14.5        37    0.0365                   K.QITLPGNK.I
 12.8        55    0.0243                   K.QPEKPK.K
 12.8        55    0.0001                   R.GALLQQIK.D
 12.8        55   -0.0111                   R.QIIRNVK.G
 12.8        55    0.0001                   R.QILLNAAK.F
 12.8        55    0.0365                   K.QILPSNAK.I
Top scoring peptide matches to query 73
denisef28QSTAR.581.3.2648.2648.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 161.9 to 161.9 min, Period: 1, Cycles(s): 2648 - 2648, Experiment 1 - 1
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 47.4     0.027   -0.0209                   K.IWDLAAGK.L
 47.4     0.027   -0.0209   13   GBLP_DROME LWDLAAGK
 33.8      0.62   -0.0209                   R.IWDIAQK.R
 17.1        29   -0.0606                   K.IAALVMAGK.S
 17.1        29   -0.0573                   R.IGAPIFAGK.K
 17.1        29   -0.1018                   K.INKVAGK.K
 17.1        29   -0.0532                   K.IRSEIAGK.L
 17.1        29   -0.0532                   R.LEIRSAGK.I
 17.1        29   -0.0532                   R.LERVTAGK.G
 17.1        29   -0.0209    7   RL4_DROME  K.IWADIQK.V
Top scoring peptide matches to query 74
denisef28QSTAR.581.3.2520.2520.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 146.5 to 146.5 min, Period: 1, Cycles(s): 2520 - 2520, Experiment 1 - 1
Score greater than 36 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 24.1       5.8   -0.0203    7   RL4_DROME K.IWADIQK.V
 23.7       6.4   -0.0203                  R.EVAWLQK.Q
 22.1       9.2   -0.0203                  R.LADWIQK.L
 18.4        21   -0.0414                  R.LSVADQLK.T
 15.0        47    0.0201                  K.EAGGGGGLGAK.G
 15.0        47   -0.0050                  K.EQLDLQK.Q
 15.0        47    0.0049                  K.NNAWLQK.K
 14.8        49   -0.0526                  R.IRTDLQK.V
 14.8        49   -0.0050                  M.LEQDIQK.I
 14.8        49   -0.0050                  K.LQEDLQK.E
Top scoring peptide matches to query 75
denisef28QSTAR.583.8.2628.2628.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 159.6 to 159.6 min, Period: 1, Cycles(s): 2628 - 2628, Experiment 2 - 2
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 52.2    0.0075   -0.0144   11   SPTCA_DROME K.ALDIFATK.L
 20.4        11    0.0034                    K.IAMPFATK.I
 13.7        53   -0.0256                    R.ADILRYK.S
 13.7        53   -0.0256                    R.ADILYRK.R
 12.8        66    0.0584                    K.ADPEFTAK.L
 11.7        84   -0.0256                    AIDYLRK
 11.7        84    0.0736                    K.ALDSDTEK.P
 11.0        99   -0.0225                    K.AEKSATK.N
 11.0        99    0.0326                    K.ANRMSATK.Q
 11.0        99   -0.0471                    R.AHTRLRLR.L
Top scoring peptide matches to query 76
denisef28QSTAR.584.8.2407.2407.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 132.93 to 132.93 min, Period: 1, Cycles(s): 2407 - 2407, Experiment 1 - 1
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 52.0    0.0073   -0.0265    8   VDAC_DROME K.VFGSLETK.Y
 18.7        16    0.0793                   K.MDEQETK.W
 18.6        16    0.0131                   K.VVRCETK.A
 18.3        17    0.0099                   R.NFELETK.F
 18.0        18   -0.0265                   R.VFSGTIEK.G
 18.0        18   -0.0265                   R.VFSGTLEK.G
 10.5    1e+002    0.0430                   K.ATAEEMTK.Y
 10.4  1.1e+002   -0.0013                   VFGASNASK
 10.4  1.1e+002   -0.0863                   R.VFGKTGK.A
 10.1  1.1e+002   -0.0169                   -.MDGSKAK.K
Top scoring peptide matches to query 77
denisef28QSTAR.588.4.2625.2625.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 159.23 to 159.23 min, Period: 1, Cycles(s): 2625 - 2625, Experiment 2 - 2
Score greater than 40 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 40.6      0.12    0.0029                   R.VGDGWLIK.G
 40.6      0.12   -0.0335    1   APLP_DROME K.VTQWILK.V
 25.3         4    0.0181                   R.DNVADLLK.D
 25.3         4   -0.0182                   R.ISQGEILK.-
 25.3         4   -0.0182                   K.QLSDAILK.E
 25.3         4   -0.0183                   K.QTVDALLK.E
 25.3         4   -0.0182                   K.SIQADIIK.K
 22.1       8.6    0.0029                   K.VHDYIIK.K
 22.1       8.6    0.0029                   K.VHDYLLK.R
 22.1       8.6   -0.0182                   R.VTAENIIK.P
Top scoring peptide matches to query 78
denisef28QSTAR.590.9.2500.2500.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 144.1 to 144.1 min, Period: 1, Cycles(s): 2500 - 2500, Experiment 1 - 1
Score greater than 35 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 37.1      0.26   -0.0230    3   PDI_DROME K.ISSFPTIK.Y
 20.4        12    0.0100                  K.LSSMVDIK.V
 17.3        25    0.0286                  K.SLSEEISK.L
 15.5        38   -0.0312                  K.LSSEKGK.N
 15.2        41   -0.0343                  K.IRFSEIK.I
 12.6        73   -0.0343                  R.LRSEFIK.R
 12.6        73   -0.0343                  R.LRSEFLK.K
 12.4        77   -0.0706                  R.ISIYRIK.V
 12.4        77   -0.0706                  K.ISLYRIK.Y
 12.4        77   -0.0706                  K.ISLYXIK.Y
Top scoring peptide matches to query 79
denisef28QSTAR.590.9.2282.2282.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 117.95 to 117.95 min, Period: 1, Cycles(s): 2282 - 2282, Experiment 1 - 1
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 20.4        12    0.0084    3   PDI_DROME K.ISSFPTIK.Y
 17.1        26    0.0084                  K.IAVSDFLK.A
 17.1        26    0.0447                  K.IEEGGFIK.A
 17.1        26    0.0447                  K.IQDEFLK.L
 17.1        26   -0.0069                  R.LFQPFLK.V
 17.1        26   -0.0280                  R.LITSAFLK.Q
 17.1        26   -0.0029                  R.LRSEFIK.R
 17.1        26   -0.0029                  R.LRSEFLK.K
 12.2        80    0.9811                  K.GSAIRFLK.T
 12.2        80    0.0084                  GSLLDFLK
Top scoring peptide matches to query 80
denisef28QSTAR.591.8.2558.2558.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 151.18 to 151.18 min, Period: 1, Cycles(s): 2558 - 2558, Experiment 2 - 2
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 53.3    0.0058   -0.0090   10   YL_DROME R.IYWVDAK.L
 33.3      0.58    0.0063                 R.LYPSTDAK.S
 26.8       2.6    1.0267                 R.FQEGVDAK.E
 22.8       6.5   -0.0301                 K.LFSDLTAK.D
 22.6       6.7   -0.0301                 K.EFVSTLAK.F
 19.8        13   -0.0899                 K.IYKQAK.I
 19.8        13   -0.0301                 K.LYEITGAK.L
 19.8        13   -0.0899                 LYQKAK
 19.8        13    0.0063                 R.LYSSEPAK.S
 18.8        16    0.0207                 R.LLCSVEGK.Y
Top scoring peptide matches to query 81
denisef28QSTAR.595.9.1783.1783.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 58.36 to 58.36 min, Period: 1, Cycles(s): 1783 - 1783, Experiment 1 - 1
Score greater than 43 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 43.1     0.072    0.0078   14   RS3_DROME K.TQQVLGEK.G
 27.9       2.4    0.0078                  M.AASQVLGEK.I
 18.1        23   -0.0398                  K.TRAQLSVK.N
 16.5        33    0.0555                  R.TPEELGEK.P
 14.9        48   -0.0286                  K.QTVQIVSK.E
 14.6        51    0.0191                  K.DIEVLEGK.P
 14.6        51    0.0191                  K.EVEVLDAK.A
 14.6        51    0.0191                  R.LDEVIEGK.L
 14.6        51    0.0290                  R.NNEVLWK.G
 14.5        52    0.0078                  K.TQQLADVK.T
Top scoring peptide matches to query 82
denisef28QSTAR.597.4.2235.2235.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 112.31 to 112.31 min, Period: 1, Cycles(s): 2235 - 2235, Experiment 1 - 1
Score greater than 33 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 47.9     0.021    0.0169   16   RL13_DROME K.GAGIGANFAK.T
 17.6        23    0.0281                   R.GQLYPEAK.D
 10.7  1.1e+002    0.0685                   R.GAGETSANAK.A
  8.7  1.8e+002    0.1018                   K.QAVYSPDNR.G
  8.5  1.8e+002   -0.0447                   R.SVILQFAK.E
  8.3  1.9e+002    0.0936                   R.AGGSNGGSGNK.P
  8.2    2e+002    0.0984                   R.GGALQMTTDR.R
  7.9  2.2e+002    0.0797                   R.GEDAVSEAK.S
  7.7  2.3e+002   -0.0083                   R.GLQLFEAK.G
  7.6  2.3e+002   -0.0351                   K.QVAGKMK.L
Top scoring peptide matches to query 83
denisef28QSTAR.600.8.2587.2587.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 154.67 to 154.67 min, Period: 1, Cycles(s): 2587 - 2587, Experiment 2 - 2
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 35.1      0.33   -0.0106   14   RS3_DROME K.FVSDGIFK.A
 18.0        17   -0.0218                  R.FVRSEFK.Y
 18.0        17   -0.0469                  K.FVTASIFK.K
 14.4        39   -0.0218                  M.FVTDFRK.E
  9.9  1.1e+002   -0.0218                  K.FRISDFK.N
  7.5  1.9e+002    1.0251                  R.ASSSLDGFK.D
  7.5  1.9e+002    0.0402                  R.EGICVAFK.V
  7.2    2e+002    0.0225                  -.MDASTLFK.K
  7.2    2e+002   -0.0775                  K.HREKAK.E
  7.2    2e+002   -0.0402                  R.HRSRSAAK.F
Top scoring peptide matches to query 84
denisef28QSTAR.601.9.2242.2242.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 113.25 to 113.25 min, Period: 1, Cycles(s): 2242 - 2242, Experiment 2 - 2
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 51.9    0.0074    0.0266    5   EF11_DROME QTVAVGVIK
 35.6      0.31    0.0154                   M.AASVARVLK.A
 24.7       3.9    1.0219                   M.EVVAAAILK.N
 18.8        15    0.0518                   K.DVNARVIK.H
 18.3        17    0.0154                   R.QISAVLRK.I
 18.3        17    0.0630                   K.QTSPQLLK.K
 13.0        58    1.0583                   K.IVDATPGLK.I
 13.0        58    1.0107                   R.VVEAVRLK.P
 12.8        60    1.0107                   R.DLVRAVLK.R
 12.7        61    1.0947                   R.EVVGEVPGK.W
Top scoring peptide matches to query 85
denisef28QSTAR.602.9.2221.2221.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 110.63 to 110.63 min, Period: 1, Cycles(s): 2221 - 2221, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 22.6       7.7    0.0153    7   RL4_DROME K.GYNLPQPK.M
 15.2        42    0.0119                  R.MHLSLTSK.M
 14.4        52    0.0477                  K.ASYFGFPK.A
 14.4        52    0.0670                  R.QDPQATEK.L
 14.4        52   -0.0697                  R.VKPGFPK.T
 12.5        79   -0.0673                  K.ELLLLSTK.C
 11.0  1.1e+002   -0.0058                  R.QVSGPLTSK.R
  9.4  1.6e+002    0.0306                  K.QDAASSLPK.K
  7.5  2.5e+002    0.9530                  R.VSTVVVSPK.F
  7.5  2.5e+002    0.9894                  K.ELLTTNPK.A
Top scoring peptide matches to query 86
denisef28QSTAR.604.3.2684.2684.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 166.33 to 166.33 min, Period: 1, Cycles(s): 2684 - 2684, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 23.6       5.4   -0.0168   11   SPTCA_DROME K.EFSMMFK.H
 14.3        46    0.9633                    R.QHNGGMFK.L
 13.6        54   -0.0168                    R.ESFICFK.L
 12.9        63   -0.0636                    R.EFPVENGK.A
  9.8  1.3e+002    0.8841                    K.AFPLTANGK.V
  9.4  1.4e+002   -0.1102                    R.GARTGLSFVR.D
  9.3  1.5e+002    0.8919                    -.MPSLLETK.G
  7.4  2.2e+002   -0.0312                    K.EFFDSFK.R
  7.2  2.4e+002    0.0018                    K.SYEDMFK.D
  7.2  2.4e+002   -0.0168                    R.TFMDMFK.K
Top scoring peptide matches to query 87
denisef28QSTAR.604.8.2390.2390.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 131 to 131 min, Period: 1, Cycles(s): 2390 - 2390, Experiment 2 - 2
Score greater than 24 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 23.4       6.1   -0.0330   19   PABP_DROME SGVGNVFIK
 10.4  1.2e+002   -0.0442                   K.AATNRFIK.L
  9.1  1.6e+002    0.0178                   K.QMVVAMNK.M
  7.6  2.3e+002   -0.0231                   R.HYRGFIK.-
  7.1  2.6e+002    0.0147                   R.EYAPEALK.R
  7.1  2.6e+002   -0.0581                   R.EYLIAALK.E
  7.1  2.6e+002   -0.0694                   K.EYLRVLK.E
  7.1  2.6e+002   -0.0217                   K.YETVPALK.E
  6.9  2.7e+002    0.9987                   R.ELVYGPNK.V
  6.9  2.7e+002   -0.0078                   K.NEFRNLK.Q
Top scoring peptide matches to query 88
denisef28QSTAR.605.3.2855.2855.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 186.8 to 186.8 min, Period: 1, Cycles(s): 2855 - 2855, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 27.1       2.4   -0.0037    6   TOP2_DROME K.VMFTCFK.R
  4.0  4.8e+002   -0.0924                   K.VTLETFLSR.R
  1.2  9.1e+002   -0.0713                   R.ETFTLWLR.F
  1.2  9.1e+002   -0.1522                   K.KVATFLSR.F
  1.2  9.1e+002   -0.1522                   R.LGKTFSIR.H
  1.2  9.1e+002   -0.0924                   R.LVTETFTVR.K
  0.1  1.2e+003   -0.1345                   K.VMFLQRK.G
Top scoring peptide matches to query 89
denisef28QSTAR.606.3.2332.2332.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 123.94 to 123.94 min, Period: 1, Cycles(s): 2332 - 2332, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 22.4       6.7   -0.0359   14   RS3_DROME GCEVVVSGK
  3.8  4.9e+002   -0.0728                  K.RNNFTSGK.I
  2.0  7.4e+002   -0.0948                  K.SKESGSGK.L
  1.1  9.1e+002    0.9854                  R.KGSAVGSDSD.-
  0.5    1e+003   -0.0656                  K.FFPPGSGSK.E
Top scoring peptide matches to query 90
denisef28QSTAR.608.8.1693.1693.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 47.71 to 47.71 min, Period: 1, Cycles(s): 1693 - 1693, Experiment 2 - 2
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  6.9  2.4e+002    0.0098    1   APLP_DROME K.GIAPQADEK.A
  5.4  3.4e+002    0.0947                   R.GVDDGEDIPR.E
  3.0  5.9e+002    0.0929                   K.QLFCDEK.Q
Top scoring peptide matches to query 91
denisef28QSTAR.608.9.2479.2479.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 141.68 to 141.68 min, Period: 1, Cycles(s): 2479 - 2479, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 20.8       9.6    0.0073   10   YL_DROME R.SLAVWPQK.G
 14.3        44   -0.0138                 K.SLGNVITPK.E
 13.0        58   -0.0138                 K.SIGNTIVPK.D
 12.9        60    0.0226                 K.SLGNVVDPK.L
 11.3        87    0.0478                 M.AEAERPAGK.E
 10.6    1e+002   -0.0502                 K.VTAGQVLLK.G
 10.3  1.1e+002   -0.0250                 R.AEAVARLAK.E
 10.3  1.1e+002   -0.0614                 R.LSAVRAALK.P
  7.1  2.2e+002    0.0226                 K.EAATPAAAVK.G
  6.3  2.7e+002    0.0348                 R.DLLESIGVAR.M
Top scoring peptide matches to query 92
denisef28QSTAR.609.4.2211.2211.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 109.43 to 109.43 min, Period: 1, Cycles(s): 2211 - 2211, Experiment 1 - 1
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 46.9     0.026    0.0334    1   APLP_DROME K.VGNANIITK.A
 29.4       1.5    0.0082                   R.VELNLLTK.D
 24.1         5   -0.0030                   R.VELRALTK.E
 24.1         5    0.0082                   K.VELVQITK.P
 21.9       8.2    0.0221                   K.VANRAGITK.S
 21.9       8.2    0.0082                   R.VLLDQITK.T
 21.9       8.2    0.0082                   R.VLPTGTITK.G
 21.9       8.2    0.0082                   K.VVELQLTK.E
 20.2        12    0.0082                   K.LGGVEIITK.G
 20.2        12    0.0082                   K.LLDNLLTK.N
Top scoring peptide matches to query 93
denisef28QSTAR.610.4.2240.2240.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 112.91 to 112.91 min, Period: 1, Cycles(s): 2240 - 2240, Experiment 1 - 1
Score greater than 44 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 60.3    0.0014    0.0123    4   UGGG_DROME R.ILSQEDVK.Y
 27.9       2.4   -0.0839                   K.LISQKAK.A
 27.6       2.5   -0.0241                   K.ILGTGELTK.A
 16.4        34   -0.0175                   R.ILMGDRVK.I
 16.4        34    0.0002                   R.ILPGXRVK.I
 16.4        34   -0.0427                   K.LILMTNVK.G
 16.4        34   -0.0241                   K.LLDTVSGVK.P
 16.4        34    0.0375                   K.PESERSVK.C
 16.2        35    0.0487                   K.IDDNLDVK.I
 16.2        35    0.0123                   K.LATPSTDVK.S
Top scoring peptide matches to query 94
denisef28QSTAR.613.3.1766.1766.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 56.32 to 56.32 min, Period: 1, Cycles(s): 1766 - 1766, Experiment 1 - 1
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 46.8     0.023    0.0218   25   PERC_DROME K.ACPSEEAGK.S
 20.1        11   -0.0509                   R.ACEAITVGK.V
 17.4        20   -0.0146                   M.ICGVDEAGK.G
 14.4        40    0.9031                   K.EMKEAGK.T
 11.4        80   -0.0653                   K.AVEFSEGAK.E
 10.5        98   -0.1017                   R.AVFTDLGSK.D
  9.1  1.4e+002   -0.1251                   R.KNFEQK.P
  9.1  1.4e+002   -0.1017                   K.LATTFEQK.V
  9.1  1.4e+002   -0.1051                   -.MISTTISGK.R
  8.9  1.4e+002   -0.1017                   R.EGVYLTAGK.L
Top scoring peptide matches to query 95
denisef28QSTAR.621.4.2656.2656.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 162.86 to 162.86 min, Period: 1, Cycles(s): 2656 - 2656, Experiment 1 - 1
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 60.7     0.001   -0.0150                  R.LILPGELAK.H
 60.7     0.001   -0.0150   23   H2B_ACRFO R.LLLPGELAK.H
 36.0       0.3   -0.0150                  K.IIIPEIQK.V
 23.2       5.7    0.0466                  R.ILLSGDHAK.I
 22.6       6.6   -0.0150                  K.ILLLEAGPK.K
 22.6       6.6   -0.0150                  K.LLLLQPEK.N
 21.9       7.7   -0.0514                  K.ILPLISLGK.W
 21.8       7.9    0.0353                  R.IIERTGHK.M
 21.8       7.9    0.0214                  R.LIPSTPPTK.K
 21.2       9.1    0.0224                  K.LILTASGGPLR.N
Top scoring peptide matches to query 96
denisef28QSTAR.625.9.2444.2444.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 137.48 to 137.48 min, Period: 1, Cycles(s): 2444 - 2444, Experiment 2 - 2
Score greater than 34 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 35.8      0.35    0.0055    2   VIT3_DROME R.LIQAYVQK.Y
 19.7        15   -0.0170                   K.LQLARHPK.R
 19.1        17    0.0055                   K.ILFSQNLK.E
 16.9        27   -0.0058                   LVGVGYRAK
  9.9  1.4e+002   -0.0058                   R.IFIGRTGAK.Q
  9.9  1.4e+002    0.0055                   R.IFLNISQK.T
  9.9  1.4e+002    0.0055                   R.IYAQIVGAK.V
  9.9  1.4e+002    0.0054                   R.LFTIGGVQK.E
  9.8  1.4e+002    0.0055                   K.ILAYQNIK.E
  9.8  1.4e+002   -0.0795                   K.LIFLGKK.Y
Top scoring peptide matches to query 97
denisef28QSTAR.628.3.2182.2182.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 105.96 to 105.96 min, Period: 1, Cycles(s): 2182 - 2182, Experiment 1 - 1
Score greater than 39 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 35.0      0.36    0.0121    1   APLP_DROME K.LDYSTPGSK.V
 24.9       3.7    0.9775                   LNYGMQIK
 19.8        12   -0.1447                   K.LRPDLLLK.L
 16.7        24   -0.0144                   K.IDYWRSK.I
 16.4        26   -0.0607                   K.ITTTYQIK.S
 16.4        26   -0.1195                   K.LPVNRQLK.F
 14.2        44    0.9597                   K.AGVTYSAGLK.A
 13.9        47   -0.0355                   K.IPANPSPSGK.K
 10.7        99   -0.0467                   R.DIAHRDLK.P
 10.6    1e+002    0.9233                   K.PVIPGDQLK.I
Top scoring peptide matches to query 98
denisef28QSTAR.628.4.2270.2270.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 116.51 to 116.51 min, Period: 1, Cycles(s): 2270 - 2270, Experiment 1 - 1
Score greater than 40 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.5       1.3    0.0297    1   APLP_DROME K.SEISYQIK.Q
 26.4       2.7    0.0991                   K.SGDEMTSLK.D
 23.0       5.7    0.0297                   K.SGDLTLSFK.D
 23.0       5.8    0.1169                   R.SEINDCIK.M
 20.9       9.3    0.1147                   K.SELSYELDR.L
 20.8       9.7    0.0661                   R.DSDYNLLK.A
 20.8       9.7    0.0073                   K.QHNTNLLK.M
 20.8       9.7    0.0661                   K.YDSDNLIK.K
 20.6        10   -0.0332                   K.SFFRGLLK.E
 20.6        10   -0.0552                   K.SIYSIIK.K
Top scoring peptide matches to query 99
denisef28QSTAR.628.8.2694.2694.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 167.43 to 167.43 min, Period: 1, Cycles(s): 2694 - 2694, Experiment 1 - 1
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 32.2      0.62   -0.0215    6   TOP2_DROME K.AMCDELLK.R
 16.7        22   -0.1312                   K.AMIHAGQLK.N
 15.3        30    0.0036                   R.MAGIACNDK.L
 14.6        35   -0.0506                   R.ATSICGSGVK.Q
  9.2  1.2e+002   -0.1013                   R.ANLAEPEPK.L
  8.3  1.5e+002   -0.1975                   R.GHKELLK.F
  8.3  1.5e+002   -0.1530                   K.RYFELIK.Y
  7.4  1.9e+002   -0.1741                   R.AQPGELILK.R
  7.4  1.9e+002   -0.1853                   K.DNRIPLLK.E
  7.4  1.9e+002   -0.1377                   R.ELTDHLLK.D
Top scoring peptide matches to query 100
denisef28QSTAR.631.9.2644.2644.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 161.42 to 161.42 min, Period: 1, Cycles(s): 2644 - 2644, Experiment 1 - 1
Score greater than 38 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 38.1      0.21   -0.0195   24   RS15A_DROME MNVLADALK
 23.0       6.9   -0.0525                    K.SSAVLAWLK.P
 17.9        22    0.9944                    R.DIDLAEAVK.R
 17.3        26   -0.0373                    R.DGATLVSLAK.G
 17.3        26    0.9944                    R.EDVLGEALK.L
 17.3        26    0.8618                    K.KAISIAVK.D
 16.9        28   -0.0009                    K.TAEVGDAIAK.E
 15.9        36    0.9943                    K.LDDPSTVVK.G
 13.1        67   -0.0737                    R.TSNITLVVK.E
 11.5        98    0.1144                    -.MCSCLVVK.N
Top scoring peptide matches to query 101
denisef28QSTAR.632.4.2503.2503.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 144.56 to 144.56 min, Period: 1, Cycles(s): 2503 - 2503, Experiment 2 - 2
Score greater than 29 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 42.4     0.082   -0.0230   18   KPYK_DROME R.VQFGLQVGK.K
 13.8        59   -0.0230                   K.IGIFGGAGVGK.T
 13.8        59   -0.0230   12   ATPB_DROME K.IGLFGGAGVGK.T
 13.8        59   -0.0230                   K.IGLFGGXGVGK.T
 13.7        60   -0.0342                   R.LGGRAAFVGK.L
 11.8        94   -0.0481                   R.ILGIFVEGK.R
 11.7        95   -0.0563                   R.KTLGEVGK.E
 11.7        95    0.0213                   R.LMELGEVGK.Q
 11.5        99   -0.0594                   R.ILFIREGK.I
 11.2  1.1e+002    1.0053                   R.MLEAAGVVGK.T
Top scoring peptide matches to query 102
denisef28QSTAR.632.4.2587.2587.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 154.56 to 154.56 min, Period: 1, Cycles(s): 2587 - 2587, Experiment 1 - 1
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 51.5    0.0099   -0.0228                   K.IGIFGGAGVGK.T
 51.5    0.0099   -0.0228   12   ATPB_DROME K.IGLFGGAGVGK.T
 51.5    0.0099   -0.0228                   K.IGLFGGXGVGK.T
 15.4        41   -0.0592                   R.IGLFRELK.V
 11.9        91    0.0102                   R.LAAMTQGVGK.E
 10.3  1.3e+002   -0.0592                   K.GIIFIERK.N
  8.8  1.9e+002   -0.0479                   LGLYPATLK
  8.7  1.9e+002   -0.0592                   R.IGFLIERK.Q
  6.7    3e+002   -0.0561                   K.GLLKESGK.K
  6.7    3e+002   -0.0076                   R.VAIVGTSGSGK.S
Top scoring peptide matches to query 103
denisef28QSTAR.635.8.2572.2572.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 152.76 to 152.76 min, Period: 1, Cycles(s): 2572 - 2572, Experiment 1 - 1
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 58.9    0.0015   -0.0216   15   VIT1_DROME R.YAMLDIEK.T
 28.7       1.5   -0.0182                   YFAPDIEK
 25.0       3.6   -0.0328                   R.PHMLIDEK.I
 19.2        14    0.0148                   R.YLSDPMEK.H
 18.8        15   -0.0216                   R.YADLLMEK.E
 18.4        16    0.0110                   K.YANDRSEK.T
 16.4        26   -0.0216                   R.YLGEMIEK.G
 16.1        28   -0.0030                   K.YSDELVEK.G
 16.0        28   -0.0030                   R.YDSVEEIK.Q
 16.0        28   -0.0030                   K.YSDEVELK.V
Top scoring peptide matches to query 104
denisef28QSTAR.636.4.2599.2599.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 156.11 to 156.11 min, Period: 1, Cycles(s): 2599 - 2599, Experiment 2 - 2
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 34.2      0.44   -0.0547   19   PABP_DROME K.LFTNVYVK.N
 18.7        16   -0.0039                   K.LFVASGCLK.S
 17.5        20    0.0181                   K.YPAQDYVK.E
 14.7        39    0.9988                   K.MQQSVYVK.D
 14.3        43    0.0213                   K.IFGCDRVK.L
 14.3        43   -0.1023                   K.LFAGLVHVK.Q
 11.2        88   -0.0151                   R.IFTRCGLK.F
  9.5  1.3e+002   -0.0039                   K.ILNFSCLK.C
  9.4  1.3e+002   -0.0183                   K.IFGYQDLK.V
  9.3  1.3e+002   -0.0506                   K.TGHIITDVK.K
Top scoring peptide matches to query 105
denisef28QSTAR.640.4.2005.2005.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 84.83 to 84.83 min, Period: 1, Cycles(s): 2005 - 2005, Experiment 1 - 1
Score greater than 21 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.2        51    0.0109   17   CALR_DROME K.QLDNPNYK.G
  7.3  2.5e+002   -0.0255                   K.GAGPLTANYK.A
  4.4  4.9e+002   -0.0619                   K.EVTRVPYK.V
  4.4  4.9e+002   -0.0489                   K.HKTGNYK.K
  4.4  4.9e+002   -0.0489                   K.KHASGGYK.E
  4.4  4.9e+002   -0.0731                   R.LLRQGNYK.V
  4.4  4.9e+002    0.9753                   K.MYKNYK.E
  4.4  4.9e+002   -0.0619                   K.NINLINYK.K
  4.4  4.9e+002   -0.0143                   R.PEELVNYK.S
  4.4  4.9e+002    0.9698                   K.PILNENYK.L
Top scoring peptide matches to query 106
denisef28QSTAR.640.4.1921.1921.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 74.79 to 74.79 min, Period: 1, Cycles(s): 1921 - 1921, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 37.0      0.27    0.0323   17   CALR_DROME K.QLDNPNYK.G
 15.2        41    0.0323                   K.VQENGPGYK.A
  9.9  1.4e+002   -0.0041                   K.DIQNGVFAK.D
  9.3  1.6e+002    0.1204                   R.GALDCAGVNNR.K
  8.0  2.1e+002   -0.0293                   K.QIDIFDIK.R
  7.6  2.3e+002   -0.0630                   R.VTRNRFAK.G
  6.9  2.8e+002    0.0170                   K.LQDFFHGK.E
  6.7  2.9e+002    1.0541                   K.QLDCELVIR.K
  5.8  3.6e+002    0.0775                   M.QTQLTEEMR.Q
  5.5  3.8e+002   -0.0153                   R.RSINTWSK.N
Top scoring peptide matches to query 107
denisef28QSTAR.640.4.1836.1836.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 64.69 to 64.69 min, Period: 1, Cycles(s): 1836 - 1836, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 23.4       6.2    0.0327   17   CALR_DROME K.QLDNPNYK.G
 17.7        23    0.9066                   K.YVLNPIK.S
 14.9        44    0.0327                   K.VQENGPGYK.A
 14.3        51   -0.0071                   K.IRSMDELK.G
 12.6        74   -0.0289                   K.IENVFLEK.E
 11.8        90    0.0293                   R.RAEMDIEK.A
 11.8        90   -0.0149                   YRSNNLPK
  9.4  1.5e+002    0.9794                   R.YPDPNIK.V
  9.4  1.5e+002    0.9794                   R.YPDPNLK.S
  8.9  1.8e+002   -0.0071                   K.RSLDMLEK.L
Top scoring peptide matches to query 108
denisef28QSTAR.641.3.2687.2687.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 166.59 to 166.59 min, Period: 1, Cycles(s): 2687 - 2687, Experiment 1 - 1
Score greater than 26 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 40.8     0.097   -0.0081   13   GBLP_DROME K.VWNLANCK.L
 11.3        88   -0.1266                   M.VGPGLGINRVR.R
  4.4  4.2e+002   -0.0179                   K.IEEVLNCK.D
  4.4  4.2e+002    0.0903                   R.SVFTCNCK.Y
  4.4  4.2e+002    0.0274                   K.YFENCK.V
  4.4  4.2e+002    1.0600                   K.YGFNTNCK.V
  4.4  4.2e+002   -0.0081                   K.YLLGHNCK.I
  3.9  4.8e+002   -0.0137                   K.VGMTQIFDAR.G
  3.2  5.5e+002   -0.0688                   K.AVDVDLSFK.D
  2.7  6.2e+002   -0.0218                   R.ERNSMTQK.R
Top scoring peptide matches to query 109
denisef28QSTAR.643.3.3058.3058.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 209.12 to 209.12 min, Period: 1, Cycles(s): 3058 - 3058, Experiment 2 - 2
Score greater than 14 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
  8.1  1.7e+002    0.9290    9   HSP7C_DROME K.FADEDKK.L
  0.6  9.4e+002   -0.0320                    K.EGYSRLFNR.E
  0.6  9.4e+002    0.9775                    K.SGEIFNSDK.D
Top scoring peptide matches to query 110
denisef28QSTAR.645.4.2171.2171.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 104.74 to 104.74 min, Period: 1, Cycles(s): 2171 - 2171, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.4       3.1    0.0332    6   TOP2_DROME R.AEEQGINLK.T
 23.5         6    0.0332                   R.AEEIANNIK.E
 19.9        14   -0.0032                   R.DTLVAQNLK.Q
 19.9        14   -0.0630                   R.KGQIGNIK.Y
 19.9        14   -0.0032                   K.LESAINNLK.S
 19.9        14   -0.0032                   R.VETALNNLK.Y
 17.5        24   -0.0256                   R.AERTGRALK.E
 12.5        76    0.0179                   R.DITQHFIK.K
 12.0        85    0.9557                   R.VTQEIVAIK.V
 11.2    1e+002    0.0220                   R.EAEQQRLK.Q
Top scoring peptide matches to query 111
denisef28QSTAR.646.3.1703.1703.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 48.9 to 48.9 min, Period: 1, Cycles(s): 1703 - 1703, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 55.5    0.0039    0.0097    6   TOP2_DROME K.LEDANEAGGK.N
 21.4        10   -0.0079                   R.LRAMAEATER.L
 16.1        34   -0.0453                   K.IMSLSNPNK.K
 15.7        37   -0.0267                   R.IGASDDLAGGK.S
 15.7        37   -0.0267                   R.IGSADDLAGGK.S
 13.9        56   -0.0267                   R.ISNGGLEEGK.P
 13.5        62   -0.0086                   R.LFPSVQWDR.G
 13.5        63   -0.0630                   R.LSDINQSVK.F
 12.7        76   -0.0297                   K.LGYLQPAETR.Y
 12.2        85   -0.0783                   R.FIVTNPNAK.S
Top scoring peptide matches to query 112
denisef28QSTAR.659.4.2583.2583.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 154.18 to 154.18 min, Period: 1, Cycles(s): 2583 - 2583, Experiment 2 - 2
Score greater than 34 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 50.9      0.01   -0.0187    4   UGGG_DROME K.EFTSLSFAK.A
 18.3        19    0.0177                   K.EFATFESAK.N
 18.3        19   -0.0309                   R.EFVEYAK.K
  9.8  1.3e+002    1.0017                   R.GAFTSAYPSK.P
  9.3  1.5e+002   -0.0187                   R.EYALTSAFK.D
  8.1    2e+002    0.0540                   R.DFAEDSFAK.R
  7.9  2.1e+002   -0.0915                   K.LYPVLPEAK.K
  7.9  2.1e+002   -0.0187                   LYSDIYGAK
  7.6  2.2e+002    0.0176                   K.EGDTVYFAK.Y
  7.6  2.2e+002   -0.0309                   K.ELYDFAK.E
Top scoring peptide matches to query 113
denisef28QSTAR.661.9.2246.2246.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 113.73 to 113.73 min, Period: 1, Cycles(s): 2246 - 2246, Experiment 2 - 2
Score greater than 21 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 17.9        21    0.0099    8   VDAC_DROME M.APPSYSDLGK.Q
  7.3  2.4e+002   -0.0265                   K.APYDATVVAK.L
  6.2  3.1e+002   -0.0377                   R.AVSPEKFTR.Y
  4.5  4.6e+002    0.9090                   K.AIQPYLGK.I
  3.0  6.4e+002    0.9939                   R.WLITDSNGK.Q
  3.0  6.5e+002   -0.0710                   K.ASASKEIGK.T
  2.7    7e+002    0.0221                   K.ADAVYLEEIR.N
  2.2  7.8e+002    0.1158                   R.AEGAAMGPAVCR.A
  1.0    1e+003    1.0092                   K.SGSVAEADVAK.M
  0.7  1.1e+003   -0.0480                   R.ASXTLQRLHR.N
Top scoring peptide matches to query 114
denisef28QSTAR.661.9.2365.2365.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 127.9 to 127.9 min, Period: 1, Cycles(s): 2365 - 2365, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 34.0      0.52   -0.0165    2   VIT3_DROME K.YNLQQLQK.N
 15.4        37   -0.0416                   K.YLLQEQLK.I
 11.6        90   -0.0416                   R.YNIPSSLLK.A
 11.3        95   -0.0572                   R.KEIEIMK.L
 11.3        95   -0.0572                   R.KELELMK.S
 11.3        95   -0.0572                   K.KIEELMK.I
 11.3        95    0.0893                   K.NGNNDELMK.N
 11.3        95   -0.0086                   K.SSIVQEIMK.R
 10.2  1.2e+002   -0.0780                   R.YLNIVLTAK.G
  9.3  1.5e+002   -0.0473                   K.YALKHMK.E
Top scoring peptide matches to query 115
denisef28QSTAR.667.9.2550.2550.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 150.21 to 150.21 min, Period: 1, Cycles(s): 2550 - 2550, Experiment 2 - 2
Score greater than 39 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 45.2     0.043   -0.0152    7   RL4_DROME K.LNPYAEVLK.R
 24.4       5.1   -0.0550                  R.ILMITQSLK.D
 21.8       9.2   -0.0339                  R.IIWSMGVLK.K
 16.2        34   -0.0186                  K.GVASMIEVIK.M
 16.2        34    0.0177                  MTTPQEVLK
 15.8        37   -0.0265                  K.LNAFLNNLK.I
 13.5        63    0.0575                  R.DWAADEVLK.Q
 13.5        63   -0.0000                  R.ESQLTEVLK.D
 13.5        63   -0.0962                  K.KTNSIVLK.S
 13.5        63   -0.0234                  NKDGEVIK
Top scoring peptide matches to query 116
denisef28QSTAR.669.9.2506.2506.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 144.92 to 144.92 min, Period: 1, Cycles(s): 2506 - 2506, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 56.8    0.0025   -0.0138    4   UGGG_DROME R.AVYDLDNIK.L
 12.1        74   -0.1100                   K.AVYNLAKK.H
  9.4  1.4e+002    0.0556                   K.AVGDDDSMLK.S
  9.3  1.4e+002    1.0066                   K.QDGFLDNLK.A
  9.0  1.5e+002   -0.1100                   R.AVFSGKGLK.E
  8.7  1.6e+002    0.0742                   K.EEDDGASSLK.P
  8.6  1.7e+002    1.0106                   R.STGSDLDRAK.L
  8.4  1.7e+002    0.9478                   K.RTDRFNIK.S
  7.9  1.9e+002   -0.0848                   K.AVQYAARK.L
  7.8    2e+002   -0.0039                   K.AFSHFSNLK.V
Top scoring peptide matches to query 117
denisef28QSTAR.669.9.2848.2848.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 185.96 to 185.96 min, Period: 1, Cycles(s): 2848 - 2848, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 42.1     0.074   -0.0101    7   RL4_DROME K.NICLPAVFK.A
 14.0        48   -0.0092                  R.YSAAPALETK.C
 12.2        72   -0.0092                  K.SDVAVDAVFK.I
 11.9        78   -0.0245                  K.NEFGLPVFK.L
 11.2        92   -0.0932                  K.YRGLVLTTK.G
 10.9        97   -0.0690                  K.VNYSPKAK.R
 10.1  1.2e+002    0.0126                  K.SSAMLTANQK.L
  9.6  1.3e+002    0.1152                  R.EGTPSDSDDK.C
  9.6  1.3e+002   -0.0537                  K.SIKNSETK.I
  9.4  1.4e+002   -0.1054                  R.VTKNAVFK.T
Top scoring peptide matches to query 118
denisef28QSTAR.670.4.2134.2134.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 100.3 to 100.3 min, Period: 1, Cycles(s): 2134 - 2134, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 18.6        17    0.0198    2   VIT3_DROME K.LNNYVETAK.A
 12.9        63    0.9059                   R.ILDALLPPAK.N
  8.3  1.8e+002    1.0330                   K.GSRESSGSRK.Q
  8.2  1.9e+002    0.9786                   K.QVLTYIDAK.E
  7.8    2e+002    0.8937                   K.ILYSVLAK.L
  7.0  2.4e+002    0.0440                   R.EYQGDPAK.V
  6.5  2.7e+002    1.0523                   R.LLDDPGPPSGAR.P
  5.9  3.2e+002   -0.0288                   R.EIFGKDAK.S
  5.4  3.5e+002    0.9786                   R.VTFVVEGATK.A
  5.4  3.5e+002    0.0772                   K.YHFVDDQK.F
Top scoring peptide matches to query 119
denisef28QSTAR.670.4.2275.2275.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 117.21 to 117.21 min, Period: 1, Cycles(s): 2275 - 2275, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 57.2    0.0023    0.0202    2   VIT3_DROME K.LNNYVETAK.A
 21.4       8.8    0.0453                   R.LNYRADDGK.D
 19.6        13    1.0671                   K.ISEESGETAK.R
 13.9        50    0.0128                   K.LYIDPMTAK.I
 13.4        56    0.0453                   R.NARDFEATK.G
 12.3        73   -0.0275                   K.NLRYGTSIK.Q
 11.6        86   -0.0751                   K.LVHINRTAK.V
 10.5  1.1e+002   -0.0097                   IQSAFRMAK
 10.3  1.2e+002   -0.0140                   IVEACKAK
 10.2  1.2e+002   -0.0284                   K.INDYLAAK.V
Top scoring peptide matches to query 120
denisef28QSTAR.670.9.2156.2156.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 102.94 to 102.94 min, Period: 1, Cycles(s): 2156 - 2156, Experiment 2 - 2
Score greater than 36 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 37.3      0.22    0.0311   20   RL9_DROME R.TINSNQCVK.I
 20.7        10    0.0059                  K.ALGSSCIEVK.W
 14.8        40   -0.0424                  R.NMVAFPFVK.D
 14.1        46   -0.0075                  K.GPSSSIEPPVAR.K
 11.9        76    0.9569                  K.MLVANYNVK.P
  9.9  1.2e+002   -0.0635                  K.NLTMLSFVK.Q
  9.9  1.2e+002   -0.0925                  R.QSLGVPPQVK.G
  9.1  1.5e+002   -0.0561                  R.AEGHEGLIVK.D
  8.2  1.8e+002    0.9236                  K.TMDVSKVK.L
  7.6  2.1e+002   -0.0683                  K.AGYENKVK.I
Top scoring peptide matches to query 121
denisef28QSTAR.670.9.2260.2260.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 115.41 to 115.41 min, Period: 1, Cycles(s): 2260 - 2260, Experiment 2 - 2
Score greater than 30 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 49.5     0.013    0.0163   26   RS2_DROME R.GSTGTLGNFAK.A
 14.6        41    1.0228                  K.EDTVLEFAK.A
 12.1        74    1.0592                  K.EDDVLDFAK.A
 10.9        98    0.0778                  R.GGNSSYPGSAR.R
 10.1  1.2e+002    0.0041                  K.GYNAQLDK.Y
  9.6  1.3e+002   -0.0426                  R.GLGHGRLGSAK.S
  9.5  1.3e+002   -0.0509                  R.KLNGMFAK.G
  9.2  1.4e+002   -0.0323                  K.QSAKEFAK.Y
  8.6  1.6e+002   -0.0475                  K.GYPLPHPK.S
  7.8    2e+002   -0.0717                  K.GFLTRLFAK.-
Top scoring peptide matches to query 122
denisef28QSTAR.676.9.2698.2698.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 168.02 to 168.02 min, Period: 1, Cycles(s): 2698 - 2698, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 46.3     0.029   -0.0092   22   FAS1_DROME K.ASAAFEDLLK.V
 11.8        82   -0.0546                   K.AACGKALLK.V
 11.8        82    0.0052                   R.AAEMMASLLK.D
 11.8        82   -0.1054                   K.AFGKGSLIK.M
 11.8        82   -0.0092                   K.AVDNYELLK.H
 11.8        82   -0.0942                   R.AVVDYLIK.N
 11.8        82   -0.0578                   R.AYDTPLIK.G
 11.8        82   -0.1054                   M.AYGQKILK.G
  9.9  1.3e+002    0.0190                   K.AEGDTKGDK.A
  9.7  1.3e+002    0.9496                   R.TVVFEDLIK.G
Top scoring peptide matches to query 123
denisef28QSTAR.678.4.2492.2492.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 143.14 to 143.14 min, Period: 1, Cycles(s): 2492 - 2492, Experiment 1 - 1
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 49.5     0.013    0.0104    1   APLP_DROME K.IMSNFDVNK.M
 17.5        21    0.0250                   R.FDPDFGLEK.A
 10.9        95   -0.0672                   K.LYATDGRK.V
  9.7  1.3e+002    0.0183                   R.LMDETSMLK.E
  9.3  1.4e+002    0.8787                   K.IISAEIPVPK.E
  8.8  1.6e+002   -0.0147                   K.LMDGDILYK.D
  8.2  1.8e+002   -0.1277                   R.PRILIDVNK.I
  8.2  1.8e+002   -0.0074                   K.QTYTVDVNK.V
  7.9  1.9e+002   -0.0104                   R.IFLGYNEISR.L
  7.9  1.9e+002   -0.0291                   R.IFVFMIGGATR.S
Top scoring peptide matches to query 124
denisef28QSTAR.681.8.2345.2345.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 125.6 to 125.6 min, Period: 1, Cycles(s): 2345 - 2345, Experiment 2 - 2
Score greater than 25 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 22.8       6.8   -0.0246    4   UGGG_DROME R.FSSLQYSDK.V
 11.1    1e+002    0.8543                   R.LRLEQISSK.T
  8.5  1.8e+002    0.8421                   K.KPAAAGVSTK.A
  8.5  1.8e+002    0.8655                   R.LALTIQTEGK.N
  8.5  1.8e+002    0.9877                   K.RQCQHEVK.D
  5.7  3.5e+002   -0.0657                   R.FRMHVEQK.D
  3.9  5.2e+002    0.8720                   K.DVMALQRLK.D
  1.4  9.2e+002   -0.0821                   K.DVAIIDATEK.V
  1.3  9.5e+002    1.0070                   K.IFYSEDDGK.T
  0.4  1.2e+003   -0.0210                   K.GSYGHRERTR.S
Top scoring peptide matches to query 125
denisef28QSTAR.683.9.2827.2827.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 183.43 to 183.43 min, Period: 1, Cycles(s): 2827 - 2827, Experiment 1 - 1
Score greater than 41 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 32.0      0.79   -0.0053    1   APLP_DROME R.ILDIYNSLK.E
 26.3         3   -0.0053                   K.IIDIYSNLK.Y
 18.8        17    0.0311                   K.ILDLYEQGK.P
 16.7        27   -0.0053                   K.ILDLYSLNK.I
 15.5        36    0.0311                   K.LLDFDNTLK.K
  9.6  1.4e+002    0.0311                   K.LEVLYENAK.K
  7.9  2.1e+002   -0.0277                   K.LLNNNIHLK.K
  7.5  2.3e+002   -0.0053                   K.LLDLLSGYGK.S
  6.6  2.8e+002   -0.0053                   K.IDLITNVYK.I
  6.6  2.8e+002   -0.0277                   K.LNGGLLLNHK.W
Top scoring peptide matches to query 126
denisef28QSTAR.687.9.2845.2845.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 185.7 to 185.7 min, Period: 1, Cycles(s): 2845 - 2845, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.6       1.4   -0.0283   16   RL13_DROME K.LILFPINEK.K
 22.6       6.9   -0.0243                   K.IILSRIDEK.S
 20.9        10   -0.0759                   K.ILIPYALKR.A
 16.6        27   -0.0243                   K.LLLEVESKR.G
 16.4        29    0.0485                   K.LNIQLNDEK.I
 15.1        39    0.0485                   R.IILENDQNK.D
 15.1        39    0.0121                   K.LLIEVNGSNK.F
 13.6        55    0.0090                   K.ILIFVNEINR.C
 13.2        60    1.0437                   R.ISGVEIPNEK.R
 12.3        74    0.1083                   R.LILEDEDEVR.P
Top scoring peptide matches to query 127
denisef28QSTAR.688.9.2770.2770.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 176.57 to 176.57 min, Period: 1, Cycles(s): 2770 - 2770, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 28.5       1.8   -0.0024   12   ATPB_DROME K.VVDLLAPYAK.G
 15.3        39    1.0431                   K.GSHVAASIFAK.L
 14.4        48    0.9946                   K.AHKEFIAK.F
 14.4        48    0.9228                   R.LRLARFIAK.K
 14.4        48    0.0616                   -.MVWHGFLAK.A
 14.4        48   -0.0249                   K.NVIRQFLAK.H
 14.4        48    0.9340                   R.QRLLVFIAK.E
 13.4        61    1.0220                   R.SGRDLLEVAK.A
 11.6        92    1.0220                   R.IEALTGERAK.E
 11.6        92    1.0220                   R.LEALRAESAK.A
Top scoring peptide matches to query 128
denisef28QSTAR.689.4.2338.2338.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 124.76 to 124.76 min, Period: 1, Cycles(s): 2338 - 2338, Experiment 2 - 2
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 39.1      0.16   -0.0318    8   VDAC_DROME K.ADSDVNIDLK.G
 31.3      0.94   -0.1311                   R.FQIRGVELK.S
 26.8       2.6    0.8672                   R.DKVNEVIK.K
 26.8       2.7   -0.0431                   K.EDSRNLDLK.D
 24.1       4.9   -0.0981                   -.MSLRLNDLK.P
 21.7       8.6   -0.0617                   K.AGMERGDLLK.I
 21.7       8.6   -0.0756                   K.IEDLMVELK.K
 21.7       8.6   -0.1532                   M.SEKLVEIK.D
 21.7       8.6   -0.0756                   VEELMVELK
 20.9        10   -0.0947                   K.LFQNVINNK.L
Top scoring peptide matches to query 129
denisef28QSTAR.691.4.3256.3256.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 228.46 to 228.46 min, Period: 1, Cycles(s): 3256 - 3256, Experiment 2 - 2
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
  5.8  3.2e+002   -0.0143    7   RL4_DROME R.LNDLFGTWK.K
  3.6  5.3e+002    0.0261                  R.YENVDLGQR.L
  2.3  7.2e+002    1.0223                  K.ITQDVRDYAR.E
  1.8  7.9e+002   -0.0102                  K.EKGQLEYAR.G
  1.8  7.9e+002   -0.0830                  K.GKITAITYAR.T
  1.6  8.4e+002    0.0747                  M.SPEGDTPNPPAR.P
  1.1  9.3e+002   -0.0102                  R.APNGPEANPVK.Q
  1.1  9.3e+002   -0.0102                  R.APSSFRTEAK.I
  1.1  9.3e+002    0.9956                  R.QETRSMRGK.E
  1.1  9.3e+002    0.9664                  K.YVPLEMRGK.A
Top scoring peptide matches to query 130
denisef28QSTAR.691.4.2885.2885.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 190.41 to 190.41 min, Period: 1, Cycles(s): 2885 - 2885, Experiment 1 - 1
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 33.0       0.6   -0.0041    7   RL4_DROME R.LNDLFGTWK.K
 13.7        51   -0.1092                  K.AREVVVPPVK.V
 11.6        84   -0.0737                  R.NLDILYAK.V
 11.6        84   -0.0000                  R.NLDLRYGDK.Q
 11.6        84   -0.0001                  K.VQDLGRDYK.P
 11.5        85   -0.0737                  R.LDNIYAIK.T
 10.3  1.1e+002   -0.0738                  R.AYSATIPVK.N
 10.3  1.1e+002   -0.0230                  R.ESCKLPVK.K
 10.3  1.1e+002   -0.0915                  R.MRGPVPLPVK.R
 10.1  1.2e+002    0.0112                  K.QVDEFLNTK.V
Top scoring peptide matches to query 131
denisef28QSTAR.691.9.2878.2878.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 189.67 to 189.67 min, Period: 1, Cycles(s): 2878 - 2878, Experiment 2 - 2
Score greater than 20 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
  9.0  1.5e+002   -0.0288                  K.APAAHRTGWK.D
  9.0  1.5e+002    0.1082                  K.EEEDTGTGEK.Q
  9.0  1.5e+002    0.9889    7   RL4_DROME R.LNDLFGTWK.K
  9.0  1.5e+002    0.9332                  K.SRSKASWK.G
  6.8  2.5e+002   -0.0648                  R.IDDLALYK.R
  6.0  3.1e+002   -0.0890                  R.VEDLIPAPLK.D
  5.1  3.8e+002    0.8829                  K.KAIYEVVK.I
  5.1  3.8e+002    0.9678                  R.IDDIVYISR.D
  5.1  3.8e+002   -0.0516                  R.IDDLVNLIPAR.L
  5.1  3.8e+002   -0.0404                  R.IDDLVNPLILN.-
Top scoring peptide matches to query 132
denisef28QSTAR.693.8.2310.2310.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 121.41 to 121.41 min, Period: 1, Cycles(s): 2310 - 2310, Experiment 2 - 2
Score greater than 29 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 59.2   0.00081   -0.0376   16   RL13_DROME R.AGESSLEECK.L
 12.8        35   -0.0012                   K.GEGTEEAECK.K
 10.5        61   -0.1958                   K.GHTEPKSAK.S
 10.3        63   -0.1256                   K.AIEAATVFCK.L
  8.8        90   -0.1490                   K.PRIYECK.T
  8.7        91   -0.1634                   K.THGFTYTK.D
  8.2    1e+002    0.9060                   R.VFSIPEECK.D
  7.2  1.3e+002   -0.1481                   R.MTRREFMK.F
  6.8  1.4e+002   -0.0827                   K.AFEMARPCK.D
  6.8  1.4e+002   -0.0775                   K.AWVTSEQEHR.E
Top scoring peptide matches to query 133
denisef28QSTAR.693.8.2301.2301.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 120.33 to 120.33 min, Period: 1, Cycles(s): 2301 - 2301, Experiment 2 - 2
Score greater than 29 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 50.2    0.0099    0.0316   16   RL13_DROME R.AGESSLEECK.L
 13.7        44   -0.0004                   R.AGESMAVSATYR.T
 10.8        87   -0.0083                   K.AWVTSEQEHR.E
  7.0  2.1e+002    0.0680                   K.GEGTEEAECK.K
  6.9  2.1e+002   -0.0834                   K.AWRQWSHK.D
  6.5  2.3e+002   -0.1517                   K.PPTEKGTPK.R
  5.9  2.7e+002   -0.1266                   K.GHTEPKSAK.S
  5.7  2.8e+002   -0.1144                   R.AHSILSNQTK.R
  5.7  2.8e+002   -0.1872                   R.ASAVRPVASLK.A
  5.3  3.1e+002   -0.1283                   K.DEVIPSLPTK.K
Top scoring peptide matches to query 134
denisef28QSTAR.705.4.2470.2470.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 140.6 to 140.6 min, Period: 1, Cycles(s): 2470 - 2470, Experiment 2 - 2
Score greater than 38 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 68.4   0.00018    0.0337    2   VIT3_DROME R.GDYILEVNAK.S
 21.0       9.8    0.0225                   R.YDGIIERQK.K
 15.4        35    0.0337                   K.GDIIYEINGK.K
 11.9        80   -0.0027                   R.FAIDIGGSLTK.L
 11.7        83    0.0636                   K.AVMEEILTFGR.S
 11.3        91    1.0065                   K.GRSFLDNIAK.E
 10.7    1e+002    0.0733                   -.MGEMLERQK.K
  9.4  1.4e+002   -0.0139                   K.AXYERLIGAK.G
  8.9  1.6e+002    1.0395                   -.MNDSITVRGK.D
  8.9  1.6e+002    0.0184                   K.ALVFFDPNAK.G
Top scoring peptide matches to query 135
denisef28QSTAR.706.4.2858.2858.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 187.16 to 187.16 min, Period: 1, Cycles(s): 2858 - 2858, Experiment 1 - 1
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 27.9         2    0.0066   13   GBLP_DROME K.LWNTLAECK.F
 14.1        48   -0.0995                   R.IKEICLSK.K
 13.5        54   -0.0995                   K.EKLISLCK.C
 13.5        54    0.9079                   R.SSLILLSLCK.D
 11.4        88   -0.1139                   K.IKELYADK.R
 11.4        88   -0.1139                   K.LEKLYEGK.A
  7.2  2.3e+002   -0.0654                   R.INGETSLYVK.N
  7.1  2.3e+002   -0.0146                   K.IASLENCISK.V
  6.9  2.5e+002    0.9906                   K.LWNTLAQCK.Y
  6.8  2.6e+002    1.0348                   R.DPALVMEACK.A
Top scoring peptide matches to query 136
denisef28QSTAR.710.9.2993.2994.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 203.21 to 203.33 min, Period: 1, Cycles(s): 2993 - 2994, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 26.8       2.5   -0.0574    3   PDI_DROME R.IFEFFGMNK.E
 17.8        20   -0.0711                  K.LYIEHSENK.N
 13.3        55   -0.0720                  K.LCVSFFRSK.F
 11.0        94   -0.0711                  K.EFIQQPENK.L
 10.2  1.1e+002    0.8392                  R.LFEEPKPK.P
  9.8  1.2e+002   -0.1924                  K.IFEKLPNK.L
  8.4  1.7e+002    0.8765                  K.IFEPNIRDK.P
  7.2  2.2e+002   -0.1924                  K.IFELPNKK.L
  7.2  2.2e+002   -0.1924                  K.IFELPXKK.L
  6.9  2.4e+002    0.9394                  K.LEEEIQENK.D
Top scoring peptide matches to query 137
denisef28QSTAR.710.9.3111.3111.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 213.49 to 213.49 min, Period: 1, Cycles(s): 3111 - 3111, Experiment 1 - 1
Score greater than 32 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 21.0        10   -0.0300    3   PDI_DROME R.IFEFFGMNK.E
 18.6        17   -0.0671                  K.GEHKFENK.Y
 18.2        19   -0.1277                  K.NILVREFNK.N
 14.1        49    0.9571                  K.YMVGFNEK.G
  9.6  1.4e+002    0.0457                  R.KCDSCVNK.L
  9.6  1.4e+002    0.8060                  K.LLIVVGNYLK.E
  9.2  1.5e+002   -0.0540                  R.QQLARVYENR.R
  7.4  2.3e+002    0.9363                  LFEFGTVYR
  7.4  2.3e+002   -0.0437                  K.LYIEHSENK.N
  7.3  2.3e+002   -0.0623                  K.MHVIDIYNK.Y
Top scoring peptide matches to query 138
denisef28QSTAR.716.4.2645.2645.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 161.54 to 161.54 min, Period: 1, Cycles(s): 2645 - 2645, Experiment 1 - 1
Score greater than 31 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 47.0     0.025   -0.0199   11   SPTCA_DROME K.ALNQAWAELK.N
 15.8        34   -0.0522                    K.RNLNVSAEIK.A
 13.8        54   -0.0199                    R.RFPPQEELK.A
 13.3        60   -0.0410                    K.ALDRALDELK.K
 12.7        68   -0.0410                    R.EVRIEEQLK.V
 12.7        68   -0.1025                    M.IATVILADSIK.E
 10.3  1.2e+002   -0.0298                    K.EAVPTSLEGIK.I
 10.3  1.2e+002   -0.1372                    R.EIVRNKIK.E
 10.3  1.2e+002   -0.0596                    K.IVERAMPSLK.Q
 10.3  1.2e+002   -0.0749                    -.MRIPLSWLK.E
Top scoring peptide matches to query 139
denisef28QSTAR.716.9.2757.2757.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 175.01 to 175.01 min, Period: 1, Cycles(s): 2757 - 2757, Experiment 1 - 1
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 58.8    0.0017   -0.0271   13   GBLP_DROME K.ALLWDLNDGK.N
 28.7       1.7   -0.0635                   R.AILWASVAEGK.S
 21.9       8.4   -0.0846                   R.ALLNITLSDGK.K
 12.8        69    1.1902                   R.ALVCLDCCGPR.D
 10.1  1.3e+002   -0.1080                   K.ALDKANAIGK.I
  9.1  1.6e+002   -0.1444                   K.IAITGKGGVGK.T
  8.8  1.7e+002   -0.1848                   K.AIIKAIFPK.S
  8.8  1.7e+002   -0.1233                   R.AIIQKNWK.I
  8.8  1.7e+002   -0.1210                   R.AILALTSTLNK.L
  8.8  1.7e+002   -0.1444                   R.ALIKNSQVK.V
Top scoring peptide matches to query 140
denisef28QSTAR.719.4.3260.3260.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 228.95 to 228.95 min, Period: 1, Cycles(s): 3260 - 3260, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 12.4        72   -0.0328   23   H2B_ACRFO K.ESYAIYIYK.V
  5.2  3.8e+002    0.9026                  K.YILGTFYK.E
  3.0  6.2e+002   -0.0764                  K.EAHLPVIENK.V
  2.8  6.6e+002   -0.0734                  R.ETAGDGKSIK.A
  2.5  7.1e+002   -0.0635                  R.SEVSYHRK.A
  1.8  8.3e+002    0.9518                  R.SGSSMASAIPIK.S
  1.8  8.3e+002   -0.0288                  SGTVVPAEDFK
  1.6  8.7e+002   -0.0500                  K.TLATXATKEDV.-
  1.5    9e+002    0.0327                  R.EDGLSWNSGGK.V
  1.0    1e+003    0.9552                  K.GSVGYADPALAK.Q
Top scoring peptide matches to query 141
denisef28QSTAR.719.4.2586.2586.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 154.44 to 154.44 min, Period: 1, Cycles(s): 2586 - 2586, Experiment 1 - 1
Score greater than 29 indicates homology
Score greater than 44 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 47.0     0.025   -0.0142   23   H2B_ACRFO K.ESYAIYIYK.V
 13.5        57   -0.0142                  K.LTFDSYLYK.T
 11.1        98    0.9626                  R.QAGRSLPEYK.K
 10.7  1.1e+002   -0.0233                  R.KCAAYLYK.S
 10.4  1.1e+002    0.0635                  R.ESFSLSPQGEGR.L
  9.2  1.5e+002    0.0221                  R.ESYLSFFEK.K
  9.1  1.6e+002    0.0433                  K.EFTWFEYK.S
  9.1  1.6e+002   -0.0255                  R.EIAIHEFYK.K
  9.1  1.6e+002    0.0365                  R.EICATIYYK.V
  8.0    2e+002    0.9262                  K.QRVNIDLYK.E
Top scoring peptide matches to query 142
denisef28QSTAR.720.9.2734.2734.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 172.34 to 172.34 min, Period: 1, Cycles(s): 2734 - 2734, Experiment 2 - 2
Score greater than 37 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.0       1.5   -0.0349    6   TOP2_DROME K.EISFVPGLYK.I
 23.3       5.6    0.0046                   K.MPVMDRLYK.T
 21.1       9.2   -0.0349                   R.EVTFVPGLYK.I
 19.6        13    1.0008                   K.ELESAQALYK.K
 14.0        47   -0.0795                   R.ELSFSLGKK.P
 11.4        87   -0.0907                   K.ELFSRKTK.V
 11.2        90    0.0120                   R.GVMGNRDIYK.K
 10.6    1e+002    0.0670                   R.GSDAGADRFEK.E
  9.7  1.3e+002    1.0371                   R.EISFSPTDQK.F
  9.4  1.4e+002   -0.0713                   K.YILAIDFGLK.K
Top scoring peptide matches to query 143
denisef28QSTAR.723.4.2446.2446.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 137.72 to 137.72 min, Period: 1, Cycles(s): 2446 - 2446, Experiment 2 - 2
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 35.0       0.4    0.0137    2   VIT3_DROME R.NFPAVPANSLK.Q
 16.9        25    0.0532                   M.SRVSVPCHVK.G
 15.9        32    0.9967                   R.GVKVFYGDK.Q
 12.7        67   -0.0187                   R.RVSSLGPGGLSK.E
 11.1        96    1.0557                   K.PYAFCVLAVK.N
 10.4  1.1e+002    0.0402                   K.EGVTLEAVPDK.S
 10.4  1.1e+002   -0.0673                   K.KRLSLPGDK.V
 10.4  1.1e+002    0.0491                   R.YYASGPLDK.Q
 10.4  1.1e+002    0.0491                   R.YYASGPLDK.Q
 10.3  1.2e+002   -0.0339                   R.HHVIAALTAPK.Q
Top scoring peptide matches to query 144
denisef28QSTAR.729.9.2727.2727.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 171.4 to 171.4 min, Period: 1, Cycles(s): 2727 - 2727, Experiment 1 - 1
Score greater than 34 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 49.2     0.014   -0.0065                  FLDGIYVSEK
 49.2     0.014   -0.0065   20   RL9_DROME K.FLDGLYVSEK.T
 18.3        18   -0.0147                  K.KDGTYVSEK.G
 13.5        53   -0.0178                  R.FFTATGGIASAK.L
 11.5        84   -0.0333                  K.FDSSKIAMK.R
  7.8    2e+002    0.0694                  R.CGGVVYAAEQK.L
  7.8    2e+002    0.0550                  K.FFNNDASVEK.A
  6.7  2.6e+002    0.0146                  K.DIFVYAWEK.D
  6.6  2.6e+002    1.0469                  R.FSEAMAASVEK.F
  6.3  2.8e+002   -0.0541                  R.FDLNLPNPIK.P
Top scoring peptide matches to query 145
denisef28QSTAR.730.4.2602.2602.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 156.47 to 156.47 min, Period: 1, Cycles(s): 2602 - 2602, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 63.1   0.00061   -0.0171   27+  ATPA_DROME R.VVDALGNAIDGK.G
 10.7    1e+002   -0.0423                   R.ALEAELLADVK.E
  9.9  1.2e+002   -0.0609                   K.VDVPMLGISLK.N
  9.8  1.3e+002   -0.0535                   R.ALEAEIRELK.D
  9.4  1.4e+002   -0.0170                   R.LCIARAIAVSPR.V
  8.8  1.6e+002   -0.0535                   K.VLREDAVELK.E
  8.2  1.9e+002   -0.0535                   K.VERELGEVIK.T
  6.8  2.5e+002    0.0006                   K.VVDQMVGAXPK.N
  6.8  2.6e+002   -0.0787                   M.LVTTTPIIEGK.R
  6.5  2.8e+002   -0.0939                   R.VITIDIALWK.F
Top scoring peptide matches to query 146
denisef28QSTAR.749.9.2538.2538.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 148.77 to 148.77 min, Period: 1, Cycles(s): 2538 - 2538, Experiment 2 - 2
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 40.0      0.12   -0.0350    6   TOP2_DROME K.ALSIEQMYQK.K
  9.4  1.3e+002   -0.1013                   K.LASIDKYEK.P
  8.6  1.6e+002    0.8836                   K.VLDGTPGGRIPK.G
  7.7  1.9e+002   -0.0994                   R.ALSIIGSDAPVRR.E
  7.6    2e+002   -0.1004                   K.ADAVATILAHTK.R
  7.2  2.2e+002   -0.0762                   R.SPSLERSYK.K
  6.1  2.8e+002   -0.1200                   K.ALSLYQLMK.D
  5.3  3.4e+002    1.0050                   K.ASIIEHADNEVR.E
  5.3  3.4e+002    0.9564                   R.ATVLEDSYRR.I
  4.5  4.1e+002   -0.1490                   R.AQVKAVEPPK.P
Top scoring peptide matches to query 147
denisef28QSTAR.751.9.1495.1495.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 29.38 to 29.38 min, Period: 1, Cycles(s): 1495 - 1495, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 18.1        17   -0.0584    2   VIT3_DROME K.NAQEQQQQLK.S
 13.8        47   -0.0228                   K.NAQIGNACHIK.P
 12.3        66    0.8407                   K.GGAGARPEVKK.E
 12.3        66    0.8155                   K.NAQIPLKASK.P
 10.7        96   -0.0835                   R.NADAQAELAALK.P
 10.0  1.1e+002    0.9481                   K.QGQEGDIEPLK.R
  9.8  1.2e+002   -0.0098                   R.NALAEEAREAER.A
  9.3  1.3e+002    0.8367                   K.LHWSKSAIK.K
  8.9  1.5e+002    0.8277                   R.ESVGQLLRALK.H
  8.8  1.5e+002    0.0073                   K.NAQYFGFTGTPR.F
Top scoring peptide matches to query 148
denisef28QSTAR.757.9.2172.2172.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 104.76 to 104.76 min, Period: 1, Cycles(s): 2172 - 2172, Experiment 1 - 1
Score greater than 35 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 42.0     0.077    0.0179    2   VIT3_DROME R.LENQPLEQGAK.V
 19.6        13   -0.0549                   K.EINQQLGIIAK.E
 17.8        20   -0.1147                   K.LEQLKPRAK.P
 16.6        27   -0.1147                   K.IEAKRQLPK.F
 14.5        43    0.0138                   K.EPFPPSSPLQK.G
 13.7        53   -0.0307                   R.IEELHGEKK.E
  9.8  1.3e+002   -0.1035                   K.ELQNPILKK.I
  9.6  1.3e+002    0.9533                   R.QLPPANKDAK.P
  7.7  2.1e+002   -0.0056                   K.KPDPNQQQK.D
  7.7  2.1e+002   -0.1399                   R.LKATPVVNLK.T
Top scoring peptide matches to query 149
denisef28QSTAR.777.9.3111.3111.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 213.59 to 213.59 min, Period: 1, Cycles(s): 3111 - 3111, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 17.9        20   -0.0325    3   PDI_DROME K.DNEIAIIGFFK.D
 13.9        51    0.0403                  K.DDQLYDWIAK.V
 11.8        83   -0.0042                  K.DNELQAAYAK.I
 10.8  1.1e+002    0.9264                  K.QEPYYLIVLK.K
 10.4  1.1e+002    0.9070                  K.GDGTYRILVK.K
 10.4  1.1e+002    0.0006                  K.QDAGEYMLVLK.N
  7.8  2.1e+002    0.9556                  K.DDAGLPPPKVTR.G
  7.7  2.1e+002    0.9546                  R.DQYNEILVK.E
  7.7  2.1e+002    0.9264                  R.FFLGDVDIIVK.Q
  7.7  2.1e+002   -0.0477                  R.FWQEFGLVLK.E
Top scoring peptide matches to query 150
denisef28QSTAR.795.4.3323.3323.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 236.44 to 236.44 min, Period: 1, Cycles(s): 3323 - 3323, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
  8.1  1.9e+002   -0.0556   23   H2B_ACRFO K.ATISSREIQTAIR.L
  5.2  3.8e+002   -0.0864                  K.ALIDIMDRARK.M
  3.3  5.8e+002    0.9953                  K.AEPYVASEYK.T
  3.3  5.8e+002    0.9163                  R.ALLDQTERARK.L
  2.8  6.5e+002    0.0900                  R.ADAEAAREDAEAAR.K
  2.4  7.1e+002   -0.0202                  R.DGLSAPSNSVQVK.P
  2.4  7.1e+002   -0.1051                  K.VAEIKQDLGGK.R
  1.7  8.4e+002    0.9050                  K.GSAASLRGAGARVK.V
  0.5  1.1e+003    0.8911                  M.DLSLLKNLSAAR.I
  0.5  1.1e+003    0.9163                  R.GAELKRESIAAR.I
Top scoring peptide matches to query 151
denisef28QSTAR.802.9.2664.2664.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 163.93 to 163.93 min, Period: 1, Cycles(s): 2664 - 2664, Experiment 2 - 2
Score greater than 31 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 41.2      0.09   -0.0276    9   HSP7C_DROME NELESYAYSLK
 16.1        29    0.9564                    R.NTLENYAYSLK.G
 12.8        62   -0.1854                    R.TLVYPLELPK.E
 10.4  1.1e+002    0.9186                    R.SIHHPYHPSLK.F
 10.3  1.1e+002    0.8714                    R.IPYAPSGEIPK.F
 10.3  1.1e+002   -0.1061                    R.VYVGMHEIPK.V
  9.9  1.2e+002   -0.1004                    K.IIENDEFVIPK.P
  9.9  1.2e+002   -0.1004                    K.IIENEDFVIPK.P
  9.9  1.2e+002   -0.1480                    K.PEEIGALHLIPK.E
  9.4  1.3e+002    0.9087                    R.IAGINHEFSTVK.G
Top scoring peptide matches to query 152
denisef28QSTAR.813.4.2513.2513.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 145.77 to 145.77 min, Period: 1, Cycles(s): 2513 - 2513, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 56.1    0.0027   -0.0195    3   PDI_DROME K.MDSTANELESIK.I
 12.4        63   -0.0381                  R.ACELQTGLEISK.I
 11.9        72   -0.0534                  R.LCGWVAVSELSK.G
 10.6        96   -0.1487                  K.AYLTRLEEAK.E
 10.2  1.1e+002    0.8363                  R.QVRHLNLELSK.F
  9.9  1.1e+002   -0.0606                  R.ATSSQLCIRAGGK.H
  9.1  1.4e+002    0.8829                  R.EVFEEAGVKGK.L
  9.0  1.4e+002   -0.1487                  K.VFTKGAGSGELK.V
  8.4  1.6e+002    0.8717                  K.AYNVRLEAEK.E
  8.4  1.6e+002    0.8677                  R.VHGFYIELSK.T
Top scoring peptide matches to query 153
denisef28QSTAR.839.0.2638.2638.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 160.7 to 160.7 min, Period: 1, Cycles(s): 2638 - 2638, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 33.2      0.59   -0.0150    3   PDI_DROME K.QLAPIYDQLAEK.Y
  9.7  1.3e+002   -0.0860                  R.LQAKTDWVRK.V
  8.4  1.8e+002    0.0367                  R.QALEEVVETNEK.K
  8.2  1.9e+002   -0.0595                  R.LETANKQLAEK.E
  7.9    2e+002    0.8993                  K.VVSELKQLAEK.A
  7.8  2.1e+002   -0.0595                  K.QIAKNAIETEK.L
  7.7  2.1e+002    0.0578                  K.QLGWDEAEIAEK.I
  7.7  2.1e+002    0.9357                  K.QLTPSKELAEK.H
  7.6  2.1e+002    0.0071                  K.IAGAFGWGDLLSGIR.K
  7.1  2.4e+002    1.0054                  R.HVDYVADQIVTK.L
Top scoring peptide matches to query 154
denisef28QSTAR.890.0.3245.3245.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 227.14 to 227.14 min, Period: 1, Cycles(s): 3245 - 3245, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 36.0       0.3   -0.0555    9   HSP7C_DROME K.VFAPEEISAMVLGK.M
 12.8        62    0.9246                    K.DGQQVRVLLYNGK.P
 12.8        62    1.0239                    K.SDLNEDGTININGK.G
 11.9        78    0.9996                    R.RDAEQKACPPGK.E
  9.7  1.3e+002    0.0723                    K.SPSDSGYSYETIGK.T
  8.7  1.6e+002   -0.0958                    K.IFNGIGVSRTEIGK.Y
  8.3  1.8e+002   -0.1322                    R.IVFNSRTGTVVIGK.N
  8.3  1.8e+002   -0.1565                    K.KLYVIGGGPNGK.L
  6.7  2.6e+002   -0.0957                    K.SSRVILEAAVFNGK.S
  6.6  2.6e+002    0.8986                    K.EGEFIKPVEIGK.L
Top scoring peptide matches to query 155
denisef28QSTAR.898.5.2574.2574.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 153 to 153 min, Period: 1, Cycles(s): 2574 - 2574, Experiment 1 - 1
Score greater than 33 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 54.4    0.0039   -0.0247    3   PDI_DROME K.SVFEGELNEENLK.K
 16.7        23   -0.0368                  K.YELPDENENLK.E
 13.6        48    0.9183                  R.SMLHHRELENLK.G
 10.3    1e+002    0.8866                  R.LGLSDYIIEEARK.G
  8.9  1.4e+002   -0.1460                  K.EKIITFEENLK.N
  7.4    2e+002    0.9448                  K.STADQEKMGIALSR.L
  7.4    2e+002    0.9448                  K.STADQEKMGLALSR.L
  7.3    2e+002    0.9746                  R.ETQSTTNELENLK.K
  7.3    2e+002   -0.1927                  R.PELVRPALERSLK.N
  6.7  2.4e+002   -0.0399                  K.SVFEAGWVQVEEK.W
Top scoring peptide matches to query 156
denisef28QSTAR.904.5.2877.2877.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 189.55 to 189.55 min, Period: 1, Cycles(s): 2877 - 2877, Experiment 2 - 2
Score greater than 23 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 41.4     0.086    0.0259    3   PDI_DROME K.VEEGVLVATVDNFK.Q
  7.6  2.1e+002    1.0463                  R.VPSENVLGEVGSGFK.V
  7.4  2.1e+002   -0.1552                  K.LLQKVKEVFK.A
  6.5  2.7e+002    0.8805                  R.SLVDVNKKSIK.Q
  5.5  3.3e+002   -0.0105                  R.VLLSDVIVDGTNFK.N
  3.0  5.9e+002   -0.0216                  R.RDLEIYLLATGQK.L
  2.5  6.6e+002    1.0635                  R.DIWGYISLNYFK.Q
  2.5  6.6e+002    0.0147                  R.EVERILENYGLGK.Q
  2.3    7e+002    1.0351                  K.VEEQAEAFQARLK.S
  2.0  7.4e+002   -0.0260                  R.EVGELVMTELKK.L
Top scoring peptide matches to query 157
denisef28QSTAR.911.5.2767.2767.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 176.31 to 176.31 min, Period: 1, Cycles(s): 2767 - 2767, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 54.1    0.0046   -0.0210   12   ATPB_DROME LVLEVAQHLGENTVR
 12.3        70    0.0332                   K.LVLEDRMREDFVR.L
  7.0  2.4e+002    0.8924                   K.LVSSSGIKLANATK.K
  5.8  3.1e+002   -0.0097                   K.LSGAEPLLALPTDQPR.P
  4.4  4.3e+002    1.0583                   R.LVELGYELGDADLNR.A
  4.0  4.8e+002   -0.0583                   R.LLDIVINSIYTNR.E
  3.0  5.9e+002    0.9985                   K.LVQNSTYQNIQPK.K
  2.8  6.3e+002    0.9435                   K.LVQPLPAGEPPMKR.D
  2.7  6.4e+002    0.0015                   M.VLLESEQFLTELTR.L
  2.3    7e+002   -0.1069                   R.IVELQYDIRLK.L
Top scoring peptide matches to query 158
denisef28QSTAR.943.5.3381.3381.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 243.23 to 243.23 min, Period: 1, Cycles(s): 3381 - 3381, Experiment 1 - 1
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 32.3      0.56   -0.0599   17   CALR_DROME K.EICTLGFDLWQVK.S
 11.0        76   -0.0736                   R.ENGVMTLQSYTQVK.S
 11.0        76    0.9200                   K.GQAQCQSKTTQVK.G
 11.0        76    0.0775                   M.RCPFCGHDDTQVK.D
  9.0  1.2e+002   -0.1624                   R.RTIRYTSTGGDVK.T
  8.8  1.2e+002   -0.1916                   R.EILHKFDVDLPK.K
  7.7  1.6e+002    0.9147                   R.EIEARLYEARFSTR.L
  7.7  1.6e+002    0.9186                   R.FENMISGIYLGEIVR.N
  7.7  1.6e+002   -0.1040                   K.EIHAHLERHGDGVK.D
  7.6  1.7e+002    0.9039                   K.TYDLSLSNLESQVK.N
Top scoring peptide matches to query 159
denisef28QSTAR.678.0.2522.2522.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 146.85 to 146.85 min, Period: 1, Cycles(s): 2522 - 2522, Experiment 2 - 2
Score greater than 22 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 32.9      0.57   -0.0230    9   HSP7C_DROME K.VTHAVVTVPAYFNDAQR.Q
  7.0  2.2e+002    0.0349                    R.DEDALPYDAFVVFDK.T
  6.8  2.4e+002   -0.1443                    R.EVAKHPPAVYVLPPAR.E
  5.6  3.1e+002    1.0109                    K.KAVITCPAYFNDAQR.Q
  3.4  5.2e+002   -0.0429                    K.DYVRTLGSEAVLCK.H
  3.4  5.2e+002    0.9412                    K.REDQKYALSVMMK.I
  1.2  8.5e+002   -0.0958                    K.PVLVVANFTPVAREGYR.V
  0.8  9.2e+002    0.1252                    R.NSFPACPQTDEVCLK.T
  0.6  9.8e+002   -0.0855                    K.FDLDLLVTHALPFDK.I
  0.6  9.8e+002    0.9424                    K.NFFSHGEIAMRPLVLR.E
Top scoring peptide matches to query 160
denisef28QSTAR.683.0.2874.2874.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 189.09 to 189.09 min, Period: 1, Cycles(s): 2874 - 2874, Experiment 1 - 1
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 16.7        24   -0.0176    4   UGGG_DROME R.DLLTHALDYVQSGESVR.V
  2.7  5.8e+002   -0.1157                   K.KYGENFLETLEK.I
Top scoring peptide matches to query 161
denisef28QSTAR.703.4.1578.1578.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 33.87 to 33.87 min, Period: 1, Cycles(s): 1578 - 1578, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  8.8  1.4e+002    0.0317   19   PABP_DROME R.GAQPQVQGTHAAAAAANNMR.N
  5.3  3.1e+002    1.0442                   K.QQGAMVPCGNPLDAMIK.V
  1.4  7.6e+002    1.0598                   K.QQPQTGDPSKSSSNSDR.I
  0.8  8.8e+002   -0.0476                   R.EGRRASDTSLTQGIVAFR.Q
  0.5  9.4e+002    0.9701                   K.GAIFIGSTNDADAISELIR.S
  0.5  9.4e+002    0.1469                   K.VSDNDEDSAEQEEDLLR.P
  0.4  9.7e+002    0.8851                   K.GKALSLPFSVESLISDR.T
  0.3  9.8e+002    1.0640                   K.PVQDIYQTEIEHGYDR.F
  0.2    1e+003    0.8981                   R.QGANPYRVTDALIEK.L
  0.2    1e+003    1.0105                   R.QGRTSSTGEEEESLAILR.R
Top scoring peptide matches to query 162
denisef28QSTAR.703.4.2145.2145.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 101.62 to 101.62 min, Period: 1, Cycles(s): 2145 - 2145, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 55.2    0.0032    0.0413   19   PABP_DROME R.GAQPQVQGTHAAAAAANNMR.N
  2.8  5.6e+002   -0.0277                   K.STRIQASLFAPNEEEK.Q
Top scoring peptide matches to query 163
denisef28QSTAR.718.7.2726.2726.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 171.28 to 171.28 min, Period: 1, Cycles(s): 2726 - 2726, Experiment 1 - 1
Score greater than 25 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 43.3      0.05   -0.0509   10   YL_DROME R.LILEFQPESHESNVLVR.S
  9.7  1.1e+002   -0.1835                 K.LLLWGQAIQVVGEVKGR.K
  8.7  1.4e+002    0.8877                 R.ILIERQEKSDTNFK.E
  8.7  1.4e+002   -0.0481                 R.LILENHQQEFERAARR.F
  8.7  1.4e+002    0.8834                 R.LLLECNVNIMKKTR.N
  8.2  1.6e+002   -0.0575                 K.EPLEFTIASYRMHK.G
  8.1  1.6e+002    0.8158                 R.LLQNIGGIGNVTVVPSKR.S
  6.5  2.4e+002   -0.0630                 R.LQLNNLLSYDFIQER.V
  3.3  4.9e+002    0.9402                 R.IILRTFEECVLGLAMVR.L
  3.0  5.3e+002   -0.1206                 K.IIRSIEDLPGVGPATAEK.L
Top scoring peptide matches to query 164
denisef28QSTAR.724.4.2766.2766.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 176.09 to 176.09 min, Period: 1, Cycles(s): 2766 - 2766, Experiment 1 - 1
Score greater than 16 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 22.9       5.4   -0.0204   12   ATPB_DROME K.VLDTGYPIRIPVGAETLGR.I
  2.5  6.1e+002    0.1671                   K.VGPVYHGSASEDMYTNR.N
  1.1  8.2e+002    0.9181                   K.PEELGGKVKSLITPNR.P
  0.8  8.8e+002    0.0359                   K.VIASRVEDYDMEALK.T
Top scoring peptide matches to query 165
denisef28QSTAR.736.8.3293.3293.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 232.93 to 232.93 min, Period: 1, Cycles(s): 3293 - 3293, Experiment 2 - 2
Score greater than 34 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 40.9     0.079    0.0044    5   EF11_DROME K.TLIDALDAILPPARPTDK.A
 19.2        12    1.0136                   R.LSSSRVKFGALDDALIAR.Y
 17.0        19    0.0044                   K.SLIEALDAILPPARPTDK.P
 10.7        83    1.1541                   R.DLAYSETNYGFAAPQK.I
  9.2  1.2e+002    1.0612                   K.LTIDAAQLGGLVSYNIDR.L
  6.4  2.2e+002   -0.0139                   K.TLLLTSLFLWIRTAYPR.F
  4.0  3.9e+002    0.9762                   K.TLLDKALTQRPDYIK.A
  3.7  4.2e+002    1.1741                   K.VDLDDMAYVIFTSGSTGK.P
  3.1  4.8e+002    1.0509                   M.NANTDILSLRVHAALDALR.R
  2.4  5.7e+002   -0.0958                   K.LTIVWETLRIKIYK.N
Top scoring peptide matches to query 166
denisef28QSTAR.1119.1.3390.3390.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 244.26 to 244.26 min, Period: 1, Cycles(s): 3390 - 3390, Experiment 1 - 1
Score greater than 21 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 60.7   0.00089   -0.0504    2   VIT3_DROME K.AASGDLIIIDLGSTLTNFK.R
  4.8  3.5e+002    0.0615                   R.ASGSRRGGSEGDTLGDLWK.R
  3.9  4.3e+002    0.0014                   K.SLSNLLINCGSTLVSLGLSR.L
  3.7  4.5e+002   -0.0526                   K.FVCLYHVREQILVKR.F
  3.0  5.3e+002    0.0451                   K.RVSVTVTGTTTDEMAINAAR.T
  2.9  5.3e+002    0.0588                   K.DAQSILKPSTPTYNDEGL.-
  2.9  5.3e+002    1.0801                   K.DATNLLNGLDFSEVSNVQR.I
  2.9  5.3e+002    0.9912                   R.EKLIVALDYWNIEDAR.K
  2.9  5.3e+002    0.9206                   R.EKLLKMLMDVEIWR.E
  2.9  5.3e+002   -0.1046                   R.EKLLQKMQSLWEK.A
Top scoring peptide matches to query 167
denisef28QSTAR.759.4.2713.2713.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 169.82 to 169.82 min, Period: 1, Cycles(s): 2713 - 2713, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 43 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 28.7       1.4   -0.0108   12   ATPB_DROME R.AIAELGIYPAVDPLDSTSR.I
  4.4  3.8e+002    0.0144                   R.ALSPFDNRVNLEIQDEK.S
  3.2  4.9e+002    0.9733                   K.AIAESTDLPQILYNVPSR.T
  3.0  5.2e+002    0.9037                   R.AITLRMLGSMASIIPERK.N
  2.4    6e+002   -0.1393                   R.AIAQLATKTGSAVTDIRK.M
  2.4    6e+002   -0.0332                   R.AALEELQQRLQFEERK.K
  1.8  6.9e+002   -0.0108                   R.GIAELAIYPAVDPLDSTSR.I
  1.7  7.1e+002    0.9288                   K.ALAERKDALQSAELEAK.L
  1.4  7.5e+002   -0.0363                   M.AIVTLAELLEAGVHFGHQAR.R
  0.4  9.4e+002   -0.0706                   R.APESVASFLNGAKTLNPK.L
Top scoring peptide matches to query 168
denisef28QSTAR.781.7.2607.2607.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 157.07 to 157.07 min, Period: 1, Cycles(s): 2607 - 2607, Experiment 2 - 2
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 66.9  8.2e-005   -0.0310   29   VIT2_DROME R.GDADFVDAIHTSAYGMGTSQR.L
Top scoring peptide matches to query 169
denisef28QSTAR.781.7.2517.2517.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 146.25 to 146.25 min, Period: 1, Cycles(s): 2517 - 2517, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 46.0     0.011   -0.0208   29   VIT2_DROME R.GDADFVDAIHTSAYGMGTSQR.L
  3.8  1.9e+002   -0.1091                   M.ADNTMTTTQRNIMAFDPK.D
  2.4  2.5e+002    0.8676                   K.HCMHVLTAPLLANTTEEK.P
  2.3  2.6e+002    0.9148                   R.RCMPARPGFPSSPAPGSSPPR.C
  1.6  3.1e+002   -0.1827                   K.TMPVAMALLRDVHNLCPK.E
  0.9  3.7e+002    0.8144                   M.TLNLYDTLSRRIVTLDCR.D
  0.2  4.3e+002   -0.0274                   K.EMCRELNVNLSITDASDSR.D
Top scoring peptide matches to query 170
denisef28QSTAR.781.7.3266.3266.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 229.67 to 229.67 min, Period: 1, Cycles(s): 3266 - 3266, Experiment 2 - 2
Score greater than 23 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 11.4        56    0.0506   29   VIT2_DROME R.GDADFVDAIHTSAYGMGTSQR.L
  9.5        88   -0.1513                   K.RQRPIHLSFDIDAFDPK.L
  8.0  1.2e+002    0.0440                   K.EMCRELNVNLSITDASDSR.D
  7.8  1.3e+002   -0.0377                   M.ADNTMTTTQRNIMAFDPK.D
  7.8  1.3e+002    0.8573                   K.DGSIAGYEIKEPFDPK.K
  7.8  1.3e+002   -0.1331                   K.TEAINMYQEVLIFDPK.N
  6.7  1.7e+002    0.0350                   ENFLYTNFEEICDIMK
  3.7  3.3e+002   -0.0742                   K.DGDDYDITGNLTLNGVTK.P
  1.9    5e+002   -0.1258                   R.NYIDTLEKDTSAWLNK.N
  1.3  5.9e+002    0.9158                   R.YINDPFHCPHGRPTIIK.F
Top scoring peptide matches to query 171
denisef28QSTAR.785.4.2768.2768.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 176.43 to 176.43 min, Period: 1, Cycles(s): 2768 - 2768, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 73.8  3.5e-005   -0.0106   24   RS15A_DROME R.QFGYVVLTTSGGIMDHEEAR.R
  1.8  5.5e+002    0.9649                    K.YTGEVAFYCYGEGK.A
  0.5  7.4e+002   -0.1487                    R.GAAPLQGLQFGIPADQLVTSAR.L
Top scoring peptide matches to query 172
denisef28QSTAR.789.4.2824.2824.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 183.07 to 183.07 min, Period: 1, Cycles(s): 2824 - 2824, Experiment 1 - 1
Score greater than 27 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 70.3  6.7e-005   -0.0295    2   VIT3_DROME R.GDADFVDAIHTSTFAMGTPIR.C
 10.4        64   -0.1645                   R.IVEKDESRVSAEFASLAAR.L
  5.3  2.1e+002    0.0983                   K.FESELNASYDQSDDGGFQGR.E
  3.7    3e+002    0.8882                   R.DGEGFVLVYSISSRSSFAR.I
  2.9  3.6e+002   -0.1000                   K.ICPLFGRPEGGLATMLDKN.-
  1.3  5.2e+002    0.8342                   R.IFRMGGAQAVAALAYGTATVPR.V
  0.6  6.1e+002    0.0026                   K.VTMNDEDMETYVFAVGTR.K
Top scoring peptide matches to query 173
denisef28QSTAR.789.4.2682.2682.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 166.09 to 166.09 min, Period: 1, Cycles(s): 2682 - 2682, Experiment 2 - 2
Score greater than 18 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 28.7       1.1   -0.0025    2   VIT3_DROME R.GDADFVDAIHTSTFAMGTPIR.C
  3.4  3.8e+002   -0.0730                   K.ICPLFGRPEGGLATMLDKN.-
  2.2    5e+002    0.9122                   R.VPIYYDHEIVGAVATFRDR.N
  1.7  5.6e+002    0.8092                   K.PLIIGGGKRGVVSTACYIAR.I
  1.1  6.5e+002    0.8555                   R.PNAAQERVYLAVPYGER.Q
  0.3  7.6e+002   -0.0202                   K.EEEWTLDRLDEIASFNVR.S
Top scoring peptide matches to query 174
denisef28QSTAR.789.4.3218.3218.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 223.89 to 223.89 min, Period: 1, Cycles(s): 3218 - 3218, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  3.4  3.8e+002   -0.0004    2   VIT3_DROME R.GDADFVDAIHTSTFAMGTPIR.C
  2.2    5e+002    1.1072                   R.ENDFEDELAESMQSYNR.E
  1.6  5.8e+002   -0.0868                   R.LQSAQQTQLHLADALTDAALN.-
  0.8  6.9e+002    0.0169                   K.ENDFVQPGERYRSWAPDR.Q
Top scoring peptide matches to query 175
denisef28QSTAR.789.7.3277.3277.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 231 to 231 min, Period: 1, Cycles(s): 3277 - 3277, Experiment 2 - 2
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.7        81    0.9776    2   VIT3_DROME R.GDADFVDAIHTSTFAMGTPIR.C
  2.1  4.6e+002   -0.1825                   R.RPRPNVAEVMNIVGNVEGK.V
Top scoring peptide matches to query 176
denisef28QSTAR.1189.5.2865.2865.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 188.11 to 188.11 min, Period: 1, Cycles(s): 2865 - 2865, Experiment 2 - 2
Score greater than 24 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 32.0       0.2   -0.0360   17   CALR_DROME K.ENFDNENWEDTWIYSK.H
  9.9        33   -0.1785                   R.QVGDYVLFSADPGFSESK.F
  6.6        69   -0.1307                   R.ENGIMQFLHMYDTYISK.K
  6.1        78    0.9331                   K.EPQGAFSGSGASEDCNKSK.S
  5.8        83    0.9630                   R.DGPEMQYTNSDSEQESK.D
  5.8        83    0.8177                   K.EDTIQGYRYGSDIIPFSK.V
  3.3  1.5e+002    0.8865                   K.EDPWLWDLEWDIQESK.Q
  3.1  1.5e+002   -0.1969                   R.LHKSTSHSSTATSSHYSK.N
  3.1  1.6e+002    0.8171                   K.ASFNSIRTXRSNPDMLDK.I
  3.1  1.6e+002   -0.1986                   K.NVLSNIDNDPNVVEPPEPK.S
Top scoring peptide matches to query 177
denisef28QSTAR.794.1.2692.2692.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 167.19 to 167.19 min, Period: 1, Cycles(s): 2692 - 2692, Experiment 1 - 1
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 41.4     0.057   -0.0243   15   VIT1_DROME R.GDAEFVDAIHTSVYGMGTPIR.S
  5.0  2.5e+002    0.8458                   R.HADPSLIATLHEAYANIVR.F
Top scoring peptide matches to query 178
denisef28QSTAR.794.1.2814.2814.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 181.86 to 181.86 min, Period: 1, Cycles(s): 2814 - 2814, Experiment 1 - 1
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 58.9     0.001   -0.0234   15   VIT1_DROME R.GDAEFVDAIHTSVYGMGTPIR.S
Top scoring peptide matches to query 179
denisef28QSTAR.794.1.3283.3283.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 231.62 to 231.62 min, Period: 1, Cycles(s): 3283 - 3283, Experiment 1 - 1
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  4.4  2.8e+002   -0.0213   15   VIT1_DROME R.GDAEFVDAIHTSVYGMGTPIR.S
Top scoring peptide matches to query 180
denisef28QSTAR.794.4.2699.2699.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 168.04 to 168.04 min, Period: 1, Cycles(s): 2699 - 2699, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 23.6       3.3    0.9786   15   VIT1_DROME R.GDAEFVDAIHTSVYGMGTPIR.S
 10.4        69   -0.1268                   R.ATDKPFLMPVEDVFSIAGR.G
  1.6  5.3e+002    0.0298                   K.TLQYVADSCTVCAQVNASK.A
Top scoring peptide matches to query 181
denisef28QSTAR.794.4.2868.2868.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 188.36 to 188.36 min, Period: 1, Cycles(s): 2868 - 2868, Experiment 1 - 1
Score greater than 23 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 30.4      0.85    1.0320   15   VIT1_DROME R.GDAEFVDAIHTSVYGMGTPIR.S
  8.7  1.3e+002   -0.1583                   -.MPKIGIIGGSGVYGVFEPK.E
  0.1  9.2e+002   -0.1357                   R.GEGELTFKELVDALSKGR.E
Top scoring peptide matches to query 182
denisef28QSTAR.817.4.2495.2495.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 143.5 to 143.5 min, Period: 1, Cycles(s): 2495 - 2495, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 83.2  3.1e-006   -0.0199    7   RL4_DROME R.QAYAVSELAGHQTSAESWGTGR.A
  0.1  6.3e+002    0.8643                  K.EGQDKIYYITADSFPAAK.S
Top scoring peptide matches to query 183
denisef28QSTAR.820.7.2796.2796.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 179.8 to 179.8 min, Period: 1, Cycles(s): 2796 - 2796, Experiment 2 - 2
Score greater than 28 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 66.6   0.00017   -0.0468   21   LAMC1_DROME R.ATYSVQGEAILDDVELQTAHR.G
 11.4        57    0.8173                    R.LLLPAVLCLGLGALVSSSGSSGVR.K
  8.9    1e+002   -0.1130                    K.LLLALDAVMQEQNFERAAQR.L
  7.9  1.3e+002   -0.1898                    R.FIFAYSFLNWLVKSHR.Y
  4.9  2.5e+002    0.0896                    K.IVPLIWQGFMAGCACTDENR.Q
  2.1  4.8e+002    0.8743                    R.WSPSTIQSLVGSTVQLRYHR.R
  1.8  5.2e+002   -0.1243                    R.DALALRGAERIVEAGMNNIFR.V
  1.1  6.1e+002    0.9445                    K.ITPAHDKDDYRTGMNHR.L
  0.6  6.8e+002   -0.1660                    -.MKFVIVTGLSGSGKSETMR.A
  0.5  6.9e+002    0.8532                    R.SLPRSASSFEGRSVPATPVLTR.G
Top scoring peptide matches to query 184
denisef28QSTAR.833.4.2678.2678.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 165.51 to 165.51 min, Period: 1, Cycles(s): 2678 - 2678, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.7        41   -0.0464    6   TOP2_DROME K.LTTTLSTNQMHAFDQNNCLR.R
  2.4  2.2e+002    0.8066                   R.TTPSYVAFNETERLIGDPAK.N
Top scoring peptide matches to query 185
denisef28QSTAR.833.7.2680.2680.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 165.75 to 165.75 min, Period: 1, Cycles(s): 2680 - 2680, Experiment 1 - 1
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 63.3   0.00036   -0.0451   25   PERC_DROME R.VAGALHELNPSASDETLFQEAR.R
  5.2  2.4e+002    0.9240                   R.DPPVPPATTDPFLLAESDEAK.V
  1.6  5.4e+002    0.0520                   K.SQCALEEYVRNQYPNQPNR.F
Top scoring peptide matches to query 186
denisef28QSTAR.835.0.3341.3341.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 238.61 to 238.61 min, Period: 1, Cycles(s): 3341 - 3341, Experiment 1 - 1
Score greater than 33 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 28.1      0.15    0.0155   21   LAMC1_DROME R.GCIDCPDCYNLVQDAADLHR.A
Top scoring peptide matches to query 187
denisef28QSTAR.837.7.3012.3012.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 204.98 to 204.98 min, Period: 1, Cycles(s): 3012 - 3012, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 38 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  2.6    2e+002   -0.1125    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
Top scoring peptide matches to query 188
denisef28QSTAR.837.8.3216.3216.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 223.75 to 223.75 min, Period: 1, Cycles(s): 3216 - 3216, Experiment 2 - 2
Score greater than 22 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 16.3        19    0.0006    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
  8.3  1.2e+002   -0.1320                   K.DYFNLSQVVWALIASRGQR.L
  2.5  4.7e+002   -0.0094                   R.DFVMDYAGFDKAMERQR.E
  1.9  5.3e+002   -0.0612                   R.DDMLEELEITPRPGPPTQGK.R
  1.6  5.7e+002    0.8711                   K.DFYELLMGRRIVQPAVLSD.-
  1.0  6.5e+002   -0.1329                   R.DGHPLFSGFVNAALKYSGKA.-
  0.7    7e+002   -0.0345                   R.DFVAAIISIPTPPANTPDESQPS.-
  0.7    7e+002    0.8355                   K.DFVARYKTMSGYQVLR.K
  0.5  7.3e+002   -0.0803                   K.DNYGISKQQAFDLLRSDPR.V
  0.4  7.5e+002   -0.0102                   K.PVWTDLSDSEIIDRFGXICR.S
Top scoring peptide matches to query 189
denisef28QSTAR.837.8.2839.2839.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 184.87 to 184.87 min, Period: 1, Cycles(s): 2839 - 2839, Experiment 1 - 1
Score greater than 25 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 69.4    0.0001    0.0195    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
  8.6  1.2e+002    0.9014                   K.SKAPTPRNDAPTPGTSTTPGLR.P
  3.2  4.2e+002   -0.1068                   K.GILTQAVTRGDGVIGEDVTPNVR.V
  0.8  7.3e+002   -0.0124                   R.SVEDIGGQLLVVSQFTLAADCR.K
Top scoring peptide matches to query 190
denisef28QSTAR.838.1.3321.3321.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 236.2 to 236.2 min, Period: 1, Cycles(s): 3321 - 3321, Experiment 1 - 1
Score greater than 19 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 20.6       5.5    0.9465    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
  4.9    2e+002    0.8548                   R.AVGVCSSLLSDERRPAFIEK.L
  2.5  3.5e+002    0.8460                   K.NYIGMGYHDTITPTVIQR.N
  2.3  3.7e+002    0.8740                   K.DDKKYPYLCITWSEK.Y
  2.3  3.7e+002    0.9229                   R.QNGRHLQYLGSGCIRMSEK.E
  1.0  4.9e+002   -0.1550                   K.FDVLDNMDWIFNELIIVK.E
  0.8  5.2e+002   -0.1705                   K.GTPFWGPSPQRLHLHRPTQR.N
Top scoring peptide matches to query 191
denisef28QSTAR.838.1.2981.2981.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 201.97 to 201.97 min, Period: 1, Cycles(s): 2981 - 2981, Experiment 2 - 2
Score greater than 17 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 15.1        29    1.0413    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
  3.2  4.5e+002    0.9362                   K.ASRAQQAGVFDAEIVPVEVPQR.K
  0.8  7.7e+002   -0.1033                   K.MMILPLVFSSLMSGLASLDAK.T
Top scoring peptide matches to query 192
denisef28QSTAR.838.1.3188.3188.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 220.59 to 220.59 min, Period: 1, Cycles(s): 3188 - 3188, Experiment 2 - 2
Score greater than 20 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 23.9       3.8    1.0452    8   VDAC_DROME K.DFVLHTAVNDGQEFSGSIFQR.T
  5.7  2.5e+002    1.0352                   R.DFVMDYAGFDKAMERQR.E
  3.6  4.2e+002    0.9834                   R.DDMLEELEITPRPGPPTQGK.R
  3.6  4.2e+002   -0.0563                   K.FDVLDNMDWIFNELIIVK.E
  3.3  4.5e+002    1.0101                   R.DFVAAIISIPTPPANTPDESQPS.-
  3.3  4.5e+002   -0.0439                   K.DFVNELEQLEPPLRRDLER.L
  3.0  4.8e+002    1.1209                   R.DFPDWAYCYLSLQMSVVQR.E
  0.2    9e+002    0.9077                   R.DFWYNIKGLREYYIAK.R
Top scoring peptide matches to query 193
denisef28QSTAR.840.1.2880.2880.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 189.91 to 189.91 min, Period: 1, Cycles(s): 2880 - 2880, Experiment 2 - 2
Score greater than 16 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 38.7      0.13   -0.0590    3   PDI_DROME K.FAQVQSLPLIVDFNHESASK.I
  1.1  7.5e+002    0.8553                  K.HVEVIYIDIADRSQVLSK.D
  0.8  8.1e+002    0.8450                  K.IRNSVPNVSAFRNNLSILSK.E
  0.2  9.2e+002    1.0395                  R.DDSVTQAAVDEALAANPDVAEK.I
  0.1  9.5e+002    1.0382                  R.RRGPAPAGYDPDGDEQEALSK.R
Top scoring peptide matches to query 194
denisef28QSTAR.846.1.2426.2426.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 135.32 to 135.32 min, Period: 1, Cycles(s): 2426 - 2426, Experiment 2 - 2
Score greater than 14 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.1       2.5   -0.0202   19   PABP_DROME R.NPPVPQLHQTQPIPQQLQGK.N
  0.2  9.5e+002    0.9629                   K.GSLDRDEFAVALHLIYRK.L
Top scoring peptide matches to query 195
denisef28QSTAR.850.1.3291.3291.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 232.69 to 232.69 min, Period: 1, Cycles(s): 3291 - 3291, Experiment 2 - 2
Score greater than 27 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 55.5    0.0027   -0.0076   10   YL_DROME K.EQQPLLLYTTQMTIMGMHLR.E
 11.3        71   -0.0375                 K.DDYLLPGVKLGVHILDTCSR.D
 11.3        71    0.9465                 K.DNYLLPGVKLGVHILDTCSR.D
  8.8  1.3e+002    0.8998                 K.NPDRILLRDVEALTLYSDR.Y
  8.7  1.3e+002    0.9623                 K.RPSVQLEEQGQGLGAEPQPRAR.A
  6.8    2e+002    0.8939                 R.PKLIICGFSAYPRTIDFK.A
  5.0    3e+002   -0.0665                 R.TPRMNEEIVGFKDVIENLR.N
  3.9  3.9e+002   -0.1094                 R.FLETSIDGILADVKNLENIR.D
  3.7    4e+002   -0.0674                 R.HPVCLLVLGMAGSGKTTFVQR.L
  2.8    5e+002    1.0413                 K.LWNDLPSYGEDENVPQNIR.R
Top scoring peptide matches to query 196
denisef28QSTAR.850.4.3297.3297.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 233.31 to 233.31 min, Period: 1, Cycles(s): 3297 - 3297, Experiment 1 - 1
Score greater than 21 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein   Peptide
 42.9     0.044    0.9431   10   YL_DROME K.EQQPLLLYTTQMTIMGMHLR.E
  5.6  2.3e+002   -0.0345                 K.DDYLLPGVELGVHILDTCSR.D
  2.8  4.5e+002    0.9408                 R.KNYQDGSYPIDAVXMPVR.N
  2.5  4.7e+002   -0.1587                 K.ASVGSPPMSVPHLDTRVLGGKR.V
  2.3  5.1e+002   -0.1338                 K.IDNFYTATIYEKGAEIIR.M
  1.4  6.2e+002    0.9132                 K.DDYLLPGVKLGVHILDTCSR.D
  1.0  6.7e+002    1.0491                 R.QVSSPEVDWSYGEPTEMLPPR.N
  0.8  7.1e+002   -0.1913                 R.ASNILPIAYIPGVTSGLSTDK.L
  0.0  8.5e+002    0.8833                 R.HPVCLLVLGMAGSGKTTFVQR.L
Top scoring peptide matches to query 197
denisef28QSTAR.877.4.2881.2881.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 190.04 to 190.04 min, Period: 1, Cycles(s): 2881 - 2881, Experiment 2 - 2
Score greater than 18 indicates homology
Score greater than 37 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 35.9     0.079   -0.0140   14   RS3_DROME K.FVDGLMIHSGDPCNDYVETATR.H
  3.6  1.4e+002    0.8762                  K.FRFFYEHTGSCIDLSNSK.I
  0.2    3e+002   -0.1743                  K.AMTDMLHTVTVIDPSGNDVTPK.K
Top scoring peptide matches to query 198
denisef28QSTAR.877.7.2890.2890.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 191.12 to 191.12 min, Period: 1, Cycles(s): 2890 - 2890, Experiment 2 - 2
Score greater than 16 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 28.6       0.6    1.0201   14   RS3_DROME K.FVDGLMIHSGDPCNDYVETATR.H
  2.1  2.7e+002    0.8598                  K.AMTDMLHTVTVIDPSGNDVTPK.K
  2.1  2.7e+002   -0.1021                  R.SSEDLSAYASISFQKQPEDLQ.-
  1.6    3e+002    0.0669                  K.FREMVSCSNCLDWQAYRMR.I
  0.1  4.2e+002    0.9421                  R.FDRTHNSAELHEQYDNHTK.E
Top scoring peptide matches to query 199
denisef28QSTAR.877.7.2759.2759.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 175.25 to 175.25 min, Period: 1, Cycles(s): 2759 - 2759, Experiment 1 - 1
Score greater than 20 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
 68.1  8.7e-005   -0.0641   28   GOSR1_DROME K.LSSLNESMSDLPASGAAAMHTLQR.H
  3.1  2.7e+002    0.9338                    K.TDCEQPRAIGEGQQAGRLLQNR.L
  2.8    3e+002    1.0006                    K.DSKGTFDWGGCSDNIDHGIK.F
  0.3  5.2e+002    0.8550                    K.IDSTLNSTENEYWKPEK.Y
  0.1  5.5e+002    0.9333                    R.GGQGAGAAAAAAGGAGQRGYGGLGNQGAGR.G
Top scoring peptide matches to query 200
denisef28QSTAR.884.4.2598.2598.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 155.99 to 155.99 min, Period: 1, Cycles(s): 2598 - 2598, Experiment 2 - 2
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 17.2        15    0.9442    4   UGGG_DROME R.YVVEPEVQFEANGGRSDGPLAK.F
  1.5  5.8e+002    0.8440                   K.PVQIFERSVYSDRYIFAK.N
  0.4  7.4e+002    0.9498                   K.NKMASNIFGTPEENPPSWAK.S
Top scoring peptide matches to query 201
denisef28QSTAR.891.4.2844.2844.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 185.48 to 185.48 min, Period: 1, Cycles(s): 2844 - 2844, Experiment 1 - 1
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 46.3     0.015   -0.0081    4   UGGG_DROME K.GELTDNDVAIDYLMNQPHVMPR.L
  4.0  2.6e+002   -0.1686                   R.EGLEYIPLRHYYHRHTR.S
  3.3    3e+002    0.8893                   M.AAAAVDPMVLGLGTSGGASGSGVVGGGVGR.A
  3.2  3.1e+002    0.9612                   M.AQEKMDLDFEADTSEGATLRR.S
  2.8  3.4e+002   -0.1772                   K.SVTLSEAGVAYFPDAVTARGTK.H
  2.5  3.6e+002    0.9105                   K.NVDISNMSQGEFLRLYESLRR.G
  1.3  4.9e+002    0.8983                   K.EAVRVHAADDMVPGNDYVIVGR.D
  1.1    5e+002    0.8061                   K.TVLEVEFPLIEGQLADLDTRLR.Q
  1.1  5.1e+002    0.9080                   K.SVSGQRNAEIEALNGEVLDLEQR.L
Top scoring peptide matches to query 202
denisef28QSTAR.894.1.2879.2879.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 189.69 to 189.69 min, Period: 1, Cycles(s): 2879 - 2879, Experiment 1 - 1
Score greater than 22 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein    Peptide
 40.3     0.073   -0.0108   20   RL9_DROME R.AVYAHFPINCVTSENNTVIEIR.N
  7.4  1.5e+002    0.9216                  R.FWAECRQHGVTVILYVGEILR.Y
  4.1  3.1e+002   -0.0334                  R.QSASGNYENVPALLDHVYTTGR.S
  3.8  3.3e+002    0.8550                  R.VLLTSVSTFIAGDLTIANLGTSEGR.F
  3.1  3.9e+002   -0.0481                  R.GLYAGAIAYIGFDGSIDSCIAIR.T
  0.9  6.4e+002    0.9660                  R.AQDAQRISCGIAEFDRVLGGGAVR.R
  0.9  6.5e+002    0.9424                  K.GIYAMASRDVFLLKNQPCYR.K
  0.2  7.5e+002    0.0489                  M.AVYTSVSDEEVSSFLDLYPDSGR.L
Top scoring peptide matches to query 203
denisef28QSTAR.933.1.2964.2964.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 200.03 to 200.03 min, Period: 1, Cycles(s): 2964 - 2964, Experiment 2 - 2
Score greater than 20 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 55.5    0.0016   -0.0412   18   KPYK_DROME K.IENQQGMHNLDEIIEAGDGIMVAR.G
  3.6  2.6e+002    0.8037                   R.AETVSISGFAAMARELASIVGSGKR.L
  1.6  4.1e+002    0.8149                   K.VTDGEAPMPGLVLIDGGKGQVEVAR.Q
  1.5  4.2e+002    0.8149                   R.VTMDAPVSSVALRQSGGYVATIGTK.F
  0.1  5.7e+002   -0.0575                   K.HDEYGAEFICQDIKPAGIISTR.S
Top scoring peptide matches to query 204
denisef28QSTAR.1399.7.2984.2984.2.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 202.33 to 202.33 min, Period: 1, Cycles(s): 2984 - 2984, Experiment 2 - 2
Score greater than 23 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 37.4     0.096    0.9444   18   KPYK_DROME K.IENQQGMHNLDEIIEAGDGIMVAR.G
  7.8        87   -0.1124                   R.GLLSQMINLAPDMEVVGAAPDAQSAR.E
  7.7        90    0.9268                   R.SQTGHPDFPGNVGYVYAEEAAR.G
  6.9  1.1e+002    0.0855                   K.LELEEDSEMDLPAFADSDDDLER.S
  5.1  1.6e+002    0.9282                   K.HDEYGAEFICQDIKPAGIISTR.S
  3.8  2.2e+002    0.9292                   K.ELQARFPNLAAPAAESICYATTNR.Q
  3.6  2.3e+002   -0.1571                   K.LVKADLLILMSDIEGLYSCDPR.I
  3.5  2.3e+002   -0.1247                   K.TKENGGEITFDSASTEVPEQVK.K
  3.0  2.6e+002    0.0040                   R.LFLQTAYASIEDAGYTPDSLCSSR.K
  2.5  2.9e+002   -0.1974                   -.XKESSFDIVSKVDLSEVANAIN.-
Top scoring peptide matches to query 205
denisef28QSTAR.979.5.2685.2685.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 166.35 to 166.35 min, Period: 1, Cycles(s): 2685 - 2685, Experiment 1 - 1
Score greater than 19 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 36.1      0.15   -0.0301   15   VIT1_DROME R.SGDVDFYPNGPAAGVPGASNVVEAAMR.A
  4.7  2.1e+002    0.9070                   R.YPERINERDVYTTPEYFLVDK.A
  2.7  3.3e+002    0.8521                   FRESRVTEGEAGGITQHIGAYQIK
Top scoring peptide matches to query 206
denisef28QSTAR.979.8.2714.2714.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 169.84 to 169.84 min, Period: 1, Cycles(s): 2714 - 2714, Experiment 1 - 1
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 28.2      0.86    0.9605   15   VIT1_DROME R.SGDVDFYPNGPAAGVPGASNVVEAAMR.A
  7.1  1.1e+002    0.9384                   K.VVSEQPNSSLYTYEGTMTLNDR.Q
Top scoring peptide matches to query 207
denisef28QSTAR.983.2.3407.3407.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 245.49 to 245.49 min, Period: 1, Cycles(s): 3407 - 3407, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 19.7       8.9   -0.0087   12   ATPB_DROME K.SLQDIIAILGMDELSEEDKLTVAR.A
 16.0        21   -0.0087                   K.SLQDIIAILGMDELSEADKLTVER.A
 14.5        30    0.0327                   K.AEQDNITYSDVRVKDFTSITGR.G
  5.9  2.1e+002   -0.0070                   R.AQLEDIAKAKNADLTAADMEAAVR.T
  5.1  2.6e+002    1.0358                   K.DYLAQHPSTHHFDLARIVIDQAVR.M
  5.1  2.6e+002    1.0070                   R.RLINENNPTVSLELCSKLDQAVR.T
  5.1  2.6e+002    0.9562                   R.YSLDSPAQATRLEKAVGAVLDQGLR.T
  5.0  2.6e+002    1.1550                   K.RGVMITPVYCNNSPYAEDAARER.A
  4.8  2.7e+002   -0.1128                   R.NTFKKLITEAQLAELNIDANLR.P
  4.5    3e+002    0.8815                   R.EAENIPVYLPNIQSLKEALTK.A
Top scoring peptide matches to query 208
denisef28QSTAR.1005.2.3232.3232.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 225.47 to 225.47 min, Period: 1, Cycles(s): 3232 - 3232, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein      Peptide
  7.6  1.4e+002    0.0495   11   SPTCA_DROME K.IAALQTVADQLIAQNHYASNLVDEK.R
  2.0    5e+002    0.9244                    K.IEQTLSIIKPNIISNNFIGNIINR.L
  1.7  5.3e+002    0.8910                    K.SGIIVNAGENGVILLTKTKEPIGTR.L
  0.5  6.9e+002    0.9809                    R.LAADPGSKIYGVPSVKASFYGPVTR.A
  0.4  7.1e+002    1.0690                    K.AALLTNELEGPDPAAKSSSYYNLR.S
  0.4  7.1e+002    1.0690                    K.AALLTNELEGPDPAAKSSSYYNLR.S
  0.2  7.5e+002    0.1321                    K.VRILPNDFQIGDFEEDDQHPGKR.K
  0.1  7.7e+002    1.1171                    K.LNVWWSPAFRDYHAFLWDEK.Y
  0.0  7.8e+002   -0.0167                    R.YQTLLGVTGSGKTFTMANIIARLNR.P
Top scoring peptide matches to query 209
denisef28QSTAR.1009.1.3280.3280.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 231.26 to 231.26 min, Period: 1, Cycles(s): 3280 - 3280, Experiment 1 - 1
Score greater than 16 indicates homology
Score greater than 36 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  8.5        29   -0.0830    4   UGGG_DROME K.AEEFLEEDSTYDYGRELAAEFIQR.L
  3.0  1.1e+002   -0.1905                   R.AEFEAAASAASGWALLVYDSHSNTLR.N
  2.9  1.1e+002   -0.0627                   R.YGSEHGDPFLGRTMGTQADYSHEVAR.D
  2.8  1.1e+002    0.8079                   R.VPAGETHTPRPSEAALAAYCPPEVAR.A
  2.8  1.1e+002    0.8378                   K.TVEQYGNEAVYIQYSSGIVGGNMTR.S
  2.8  1.1e+002    0.8378                   K.TVEQYGNEAVYIQYSSGIVGGNMTR.S
  2.7  1.1e+002   -0.1334                   K.TVEIPGCPHHVTPYFSYPVAISCK.C
  1.9  1.3e+002    0.8250                   K.QSESSFITGDINSSASLNREGLLNNAR.D
  1.6  1.4e+002    0.8383                   K.TVEKNEQDATETTAQNGEVAEEAK.P
  1.6  1.4e+002    0.8378                   K.TVEQYGNEAVYIQYSSGIVGGNMTR.S
Top scoring peptide matches to query 210
denisef28QSTAR.1011.5.2625.2625.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 159.13 to 159.13 min, Period: 1, Cycles(s): 2625 - 2625, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  7.7        95   -0.0676   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  2.0  3.5e+002   -0.0831                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.2  4.3e+002    0.8410                   R.CPAIPDGLVPATTVSYYVTPVQPLLAR.A
  1.2  4.3e+002   -0.0928                   K.TYNYTLGADDLTPFGEQQLVNSGIK.F
  0.3  5.2e+002    0.9948                   R.EDDWQSDLVYWGAGNKMLSDNR.D
  0.0  5.5e+002    0.8689                   K.EAGALLSYDPNLREALWPSREEAR.T
Top scoring peptide matches to query 211
denisef28QSTAR.1011.5.2514.2514.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 145.89 to 145.89 min, Period: 1, Cycles(s): 2514 - 2514, Experiment 2 - 2
Score greater than 18 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 26.5       1.4   -0.0472   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  4.0  2.5e+002    0.9739                   R.MREDTVTSSDLSNKLFDNVSGNSAR.L
  3.1  3.1e+002   -0.0611                   R.IYGYDEIPSSLPVFGEVTSGELTDR.Q
  1.8  4.2e+002    1.0152                   R.EDDWQSDLVYWGAGNKMLSDNR.D
Top scoring peptide matches to query 212
denisef28QSTAR.1011.5.3294.3294.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 232.95 to 232.95 min, Period: 1, Cycles(s): 3294 - 3294, Experiment 1 - 1
Score greater than 17 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 14.7        21   -0.0472   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  3.2    3e+002    0.9125                   K.ASSATGWAYYVKSKAGDYSTDAR.T
  2.4  3.6e+002   -0.0627                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.8  4.1e+002   -0.1007                   R.SGETEDSTIADIAVATNAGQIKTGAPAR.S
  1.3  4.6e+002    0.0488                   K.DCPVSNINNSSIPSALPEPMTASEAAAR.K
  1.3  4.6e+002    0.9739                   R.MREDTVTSSDLSNKLFDNVSGNSAR.L
  0.6  5.5e+002    0.8893                   K.EAGALLSYDPNLREALWPSREEAR.T
  0.6  5.5e+002   -0.1549                   M.ESPQLCLVLLVLGFSSGGVSATPVLEAR.P
  0.3  5.9e+002   -0.1523                   R.SSRSVAVDGAQPYTITIAPGLLADDAR.L
  0.2    6e+002    1.0152                   R.EDDWQSDLVYWGAGNKMLSDNR.D
Top scoring peptide matches to query 213
denisef28QSTAR.1011.5.2717.2717.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 170.2 to 170.2 min, Period: 1, Cycles(s): 2717 - 2717, Experiment 1 - 1
Score greater than 17 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.9      0.68   -0.0319   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  3.1  3.3e+002   -0.0810                   K.LSAPVKYAPYMPPQPPPDPWHEAR.M
  2.8  3.5e+002   -0.1743                   K.DPDGYGAKQEPLILTAVTKVEEAR.V
  2.8  3.5e+002    0.0081                   R.VTNSSEFMMNKDIMLTAVPMEEAR.T
  2.2    4e+002   -0.0480                   R.TLATSSLPLSPTLASNSQGSQGDQRTDR.S
  2.2    4e+002   -0.0481                   R.TLATSTLPVSPTLASNSQGSQGDQRTDR.G
  2.0  4.3e+002   -0.0305                   -.MIEMYDRNYIYNMTTKIMNR.S
  2.0  4.3e+002   -0.0305                   -.MIEMYDRNYIYNMTTKIMNR.S
  1.6  4.6e+002   -0.0474                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.6  4.6e+002    0.0774                   R.YMLVDGHGNFGSIDGDAAAAMRYTEAR.M
Top scoring peptide matches to query 214
denisef28QSTAR.1011.5.2987.2987.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 202.59 to 202.59 min, Period: 1, Cycles(s): 2987 - 2987, Experiment 1 - 1
Score greater than 20 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 12.0        44   -0.0199   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  6.6  1.5e+002    1.0425                   R.EDDWQSDLVYWGAGNKMLSDNR.D
  6.1  1.7e+002   -0.0354                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  3.3  3.3e+002   -0.0311                   K.TYQPEPQVGPSEWNTSIENVKAGGR.A
  3.1  3.5e+002    0.0585                   K.GSGLQGHIMENPQYFSDTCVHHIK.R
  2.4    4e+002   -0.1598                   R.FVNTMTQKASFEQLLPLPAAEHK.V
  2.4    4e+002    0.8142                   FVNTMVQQPTIDQLLPLPKSDSK
  1.9  4.5e+002    0.0395                   K.TEDPTVNRYHVRWFPEACAHNR.T
  1.9  4.6e+002   -0.1929                   K.QNPVTPPELFGSILGTHFINKYK.H
  1.3  5.2e+002    0.9883                   R.FVNAADAQVYDFRDNEVPGNTEK.D
Top scoring peptide matches to query 215
denisef28QSTAR.1011.5.2803.2803.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 180.64 to 180.64 min, Period: 1, Cycles(s): 2803 - 2803, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 10.5        64   -0.0091   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  5.4  2.1e+002    1.0533                   R.EDDWQSDLVYWGAGNKMLSDNR.D
  1.6    5e+002   -0.0246                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.6    5e+002    0.9991                   R.FVNAADAQVYDFRDNEVPGNTEK.D
  0.2  6.9e+002    0.0693                   K.GSGLQGHIMENPQYFSDTCVHHIK.R
Top scoring peptide matches to query 216
denisef28QSTAR.1011.5.3210.3210.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 222.93 to 222.93 min, Period: 1, Cycles(s): 3210 - 3210, Experiment 1 - 1
Score greater than 24 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 15.1        24    0.0080   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
 10.9        63   -0.0946                   R.FSPEDIRLAYALLERVGLDGMHNK.R
  5.1  2.3e+002    0.0007                   K.FVVDNTGEIFPGLLVSGMAVCAVHGGPR.M
  3.5  3.4e+002   -0.0075                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  2.1  4.6e+002   -0.1830                   R.LEYALVKGIEKHIIEDTEEAR.L
  1.3  5.7e+002    0.0107                   R.GGDRGPVHSETRIDGYYVPNPSGSAR.T
  1.3  5.7e+002    0.0107                   R.GGDRGPVHSETRIDGYYVPNPSGSAR.T
  1.2  5.7e+002    0.0177                   K.RPDGEMNIASGCPRFVAHSVLENAK.N
  0.6  6.6e+002   -0.1650                   K.QNPVTPPELFGSILGTHFINKYK.H
  0.5  6.8e+002    0.9030                   K.FVVNPVVTYTLYADAKWNGANEK.L
Top scoring peptide matches to query 217
denisef28QSTAR.1011.8.3360.3360.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 240.85 to 240.85 min, Period: 1, Cycles(s): 3360 - 3360, Experiment 1 - 1
Score greater than 21 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.3        69    0.9497   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  7.9        97    0.9342                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  4.2  2.2e+002   -0.1313                   R.GLDITITTSANTDAEGRALLAAFNFPIP.-
  3.2  2.8e+002   -0.1457                   K.FVSYGINVWGIDKNKDNYEIAR.E
  3.1  2.9e+002   -0.1497                   K.FVIACFLFFSASAHNVLLPAYGRR.C
  3.1  2.9e+002   -0.1376                   K.FVIGVQWHPEYLNDNGIDLQLFK.A
  3.0  2.9e+002    0.8416                   K.APLFSFDERAALISRALSETLPGEAAR.V
  2.9    3e+002   -0.1248                   R.FSLIVVDSVMALYRTDFSGRGELSAR.Q
  2.2  3.5e+002    0.9832                   R.ECQIAICITMYNEDKYSLAR.T
  2.1  3.6e+002    0.9128                   DFVFPMFRANAIYEGHYLLGTSIAR
Top scoring peptide matches to query 218
denisef28QSTAR.1011.8.2687.2687.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 166.7 to 166.7 min, Period: 1, Cycles(s): 2687 - 2687, Experiment 2 - 2
Score greater than 19 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 19.7       7.2    0.9749   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  5.0  2.1e+002    0.8567                   K.FVKSNAIVYAKDGMTIGVGAGQMSR.V
  1.9  4.3e+002    0.9594                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.8  4.4e+002    0.8325                   K.DPDGYGAKQEPLILTAVTKVEEAR.V
  0.4  6.1e+002   -0.1124                   K.FVIGVQWHPEYLNDNGIDLQLFK.A
Top scoring peptide matches to query 219
denisef28QSTAR.759.1.2719.2719.4.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 170.44 to 170.44 min, Period: 1, Cycles(s): 2719 - 2719, Experiment 1 - 1
Score greater than 14 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  2.6  3.9e+002    0.9946   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  1.1  5.5e+002    0.8345                   K.TMVEGLRQVAALADPIGEISNLKYR.P
Top scoring peptide matches to query 220
denisef28QSTAR.1011.8.3228.3228.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 224.99 to 224.99 min, Period: 1, Cycles(s): 3228 - 3228, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 18.1        12    1.0121   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  4.5  2.7e+002    0.9966                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  3.8  3.1e+002    0.8541                   K.TMVETKKVTSSGVLLLDNYSDR.I
  2.9  3.9e+002    0.8211                   R.LEYALVKGIEKHIIEDTEEAR.L
  1.9  4.9e+002    0.9044                   M.ESPQLCLVLLVLGFSSGGVSATPVLEAR.P
  1.6  5.2e+002    1.0048                   K.FVVDNTGEIFPGLLVSGMAVCAVHGGPR.M
  1.6  5.2e+002    0.0711                   K.QEMNPNFRITDPLNPVHMMSFSGAR.G
  1.6  5.2e+002    0.8172                   R.FAYAAIYSMRAMLSLVKEIVPAR.I
  1.0    6e+002   -0.1367                   R.VPLSEAIYTNTLLNIPYLFFFNR.N
  1.0    6e+002   -0.0752                   K.FVIGVQWHPEYLNDNGIDLQLFK.A
Top scoring peptide matches to query 221
denisef28QSTAR.1011.9.3068.3068.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 209.91 to 209.91 min, Period: 1, Cycles(s): 3068 - 3068, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 42 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  3.4  3.6e+002    1.1258   17   CALR_DROME K.FVLTPGTFYNDAEADKGIQTSQDAR.F
  2.4  4.6e+002    1.1103                   R.FVIGGPAGDTGVTGRKLMVDTYGGCAR.H
  1.3  5.8e+002    1.0296                   K.SGDSVGARVDVVAGGVPAGWGEPIYGK.L
  1.1  6.1e+002    1.1415                   K.TLSSMIMEDTSGDYKNALLSLVGSDP.-
  1.0  6.3e+002    0.1342                   R.ILVINKCLLDDEAEYSCEVRTAR.T
  0.9  6.4e+002    0.0304                   K.FVSYGINVWGIDKNKDNYEIAR.E
  0.9  6.4e+002   -0.0230                   R.VPLSEAIYTNTLLNIPYLFFFNR.N
  0.9  6.4e+002   -0.0230                   R.VPLSEAIYTNTLLNIPYLFFFNR.N
  0.8  6.7e+002   -0.0851                   K.VPGNLTSVLLNNLHPREQYVVRAR.V
  0.6  6.9e+002    0.0237                   R.ITPKVTALTGCHLLFCRAIGGPSAAR.V
Top scoring peptide matches to query 222
denisef28QSTAR.1028.8.2779.2779.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 177.65 to 177.65 min, Period: 1, Cycles(s): 2779 - 2779, Experiment 1 - 1
Score greater than 30 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 17.4       7.8   -0.0257    2   VIT3_DROME R.CGDVDFYPNGPSTGVPGSENVIEAVAR.A
Top scoring peptide matches to query 223
denisef28QSTAR.1029.2.2803.2803.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 180.54 to 180.54 min, Period: 1, Cycles(s): 2803 - 2803, Experiment 1 - 1
Score greater than 14 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 25.3       1.5    0.9940    2   VIT3_DROME R.CGDVDFYPNGPSTGVPGSENVIEAVAR.A
  0.4  4.4e+002    0.8949                   R.KWEQAGAAETLRAYLEGACVEWLR.R
  0.0  4.8e+002    1.0539                   -.MSTSSALSSYYVDTIMGHEAEDVYGAR.Y
Top scoring peptide matches to query 224
denisef28QSTAR.1090.2.2962.2962.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 199.69 to 199.69 min, Period: 1, Cycles(s): 2962 - 2962, Experiment 1 - 1
Score greater than 14 indicates homology
Score greater than 36 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  9.1        27   -0.0817    2   VIT3_DROME R.CGDVDFYPNGPSTGVPGSENVIEAVARATR.Y
  0.9  1.8e+002   -0.1832                   K.EHFNGGKYITWRLFAVSAHSNVCAAR.I
Top scoring peptide matches to query 225
denisef28QSTAR.1096.9.3341.3341.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 238.72 to 238.72 min, Period: 1, Cycles(s): 3341 - 3341, Experiment 2 - 2
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 41.8     0.047   -0.0346    5   EF11_DROME K.SGDAAIVNLVPSKPLCVEAFQEFPPLGR.F
  2.8  3.8e+002    1.1830                   K.WGVSMPSMQRTGMDFGEIMELERADNR.Q
  2.6  3.9e+002    0.0958                   K.TEEDLCVGCFQPIPMDSSDLKPVLK.H
  1.8  4.7e+002    0.9105                   K.YMAVALLYRGDAVPRDCNAAIAALK.A
  1.6  4.9e+002    0.8684                   K.SGEGTLILAEKNTYSGFTNINAGILK.M
  1.1  5.7e+002    0.9282                   R.DVTEEEGNIVIYTEPTDLHKGIAALK.A
  0.7  6.1e+002   -0.0825                   R.MGKTEIIAETGAGQHGVASALACALLGLK.C
  0.6  6.2e+002    0.8871                   R.GSAGEMGIVYGHTELLSTLPAGVVNVRK.G
  0.1    7e+002    1.0709                   K.ENSADPHYVQRNIMNRGTVISTELGDAR.I
Top scoring peptide matches to query 226
denisef28QSTAR.1097.3.3441.3441.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 246.95 to 246.95 min, Period: 1, Cycles(s): 3441 - 3441, Experiment 1 - 1
Score greater than 18 indicates homology
Score greater than 41 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 19.8       7.3    1.0250    5   EF11_DROME K.SGDAAIVNLVPSKPLCVEAFQEFPPLGR.F
  4.8  2.4e+002    0.0726                   K.REVLEKEFEGFSDGMQANGFSPAAIK.A
  3.2  3.3e+002    1.1658                   K.AGAPLCQTSWVTGYATDIGKGWRMDGGR.T
  3.2  3.4e+002   -0.1393                   K.ESLVVAGSFLKGAKFLPVDSEHAALK.F
  3.2  3.4e+002    0.0032                   K.IAIPVHPIVRPRGGDFCYNATEFAAIK.Y
  3.2  3.4e+002    0.8668                   R.LPAGFGARVHPSPFPDAKLVSVNPAALK.L
  3.2  3.4e+002    1.1016                   K.LQLFQPSFEICPFESELNMDIAAALK.R
  3.2  3.4e+002    0.9970                   R.QMAAALLRRLLSSGFEEVYPNLPADVQR.D
  3.2  3.4e+002   -0.0529                   K.TSYISPVPGGVGPMTIASLLMNTLQAAALK.-
  2.6  3.8e+002    0.9141                   R.YDQPAPMLDRPAKGTDGALLAVTAIK.N
Top scoring peptide matches to query 227
denisef28QSTAR.1247.3.2835.2835.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 184.39 to 184.39 min, Period: 1, Cycles(s): 2835 - 2835, Experiment 1 - 1
Score greater than 15 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 30.9      0.39   -0.0547    4   UGGG_DROME R.GQYQALSQDPNSLSNLDQDLPNNMIHQVAIK.S
  0.5  4.4e+002    0.8837                   R.ENGIPYLGLCLGMQVMVIEFARHVLQSDK.A
  0.5  4.4e+002    0.8480                   K.TDFSLFIGVAIFTYEGICLILPIQEQMAK.P
  0.2  4.6e+002    0.8127                   R.DTVAIYLTPESRSSFKQALEALPQLASGADK.K
Top scoring peptide matches to query 228
denisef28QSTAR.1261.9.3382.3382.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 243.35 to 243.35 min, Period: 1, Cycles(s): 3382 - 3382, Experiment 1 - 1
Score greater than 32 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 29.0      0.12    0.0103   17   CALR_DROME K.LFDCSLDQTDMHGESPYEIMFGPDICGPGTK.K
Top scoring peptide matches to query 229
denisef28QSTAR.1295.0.3272.3272.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 230.29 to 230.29 min, Period: 1, Cycles(s): 3272 - 3272, Experiment 1 - 1
Score greater than 20 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 21.1         4   -0.0768    2   VIT3_DROME K.WLTATELENVPSLNDITWERLENQPLEQGAK.V
  5.9  1.3e+002   -0.0716                   R.WVVSSPQEAGLTNGYEHPARLGADRWVAMIGAR.H
  1.1    4e+002    1.0558                   K.WLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGR.E
  0.9  4.1e+002   -0.0041                   M.NLDSTALAYQSGFGNEFSSEALPGALPVGQNSPQK.A
  0.7  4.4e+002    0.9985                   R.LIDEIVQLAAYTPTDHFEQYIMPYMNLNPAAR.Q
  0.4  4.6e+002    0.8179                   K.INNVMYFQIDNKTGAISLTPEGSQVLDPIK.N
  0.3  4.8e+002   -0.1589                   K.WYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCK.I
  0.3  4.8e+002   -0.1297                   -.MASLIYRQLLYNSYSVDLSDEITNIGAEK.K
  0.2  4.9e+002   -0.1892                   K.LNLLTEYIEGGTLKDFLRNADPFPWQQK.V
Top scoring peptide matches to query 230
denisef28QSTAR.971.5.3290.3290.4.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 232.46 to 232.46 min, Period: 1, Cycles(s): 3290 - 3290, Experiment 1 - 1
Score greater than 28 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 22.1       3.4   -0.0442    2   VIT3_DROME K.WLTATELENVPSLNDITWERLENQPLEQGAK.V
 14.1        21   -0.1971                   K.YNEEHGIVPQALNKKVGELLDIGQGANQK.A
 12.1        34   -0.1669                   K.QEEVLHILHGLGWTLRDYVRGYILQDAAGK.V
 12.1        34   -0.1669                   K.QEEVLHILHGLGWTLRDYVRGYILQDAAGK.V
  5.5  1.5e+002    1.0382                   K.GVSFVDPISCSLSEDSNFGTDVIIEPQTHLRGK.C
  4.8  1.8e+002   -0.0075                   R.RPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAK.V
  2.1  3.4e+002    0.9573                   K.PREQEAVCPGEGTGSGGLLPQSGALDPELKVSPK.E
  2.1  3.4e+002   -0.0240                   R.WPGRLTVDELHPPIPGYECPPNHQLVEVVEK.L
  1.5  3.9e+002    0.9330                   K.SVANSQDIDLVVDANAVAYNSSDVKDITADVLK.Q
  1.4    4e+002    1.0352                   R.LEHFSGAVYEGQFKDNMFHGLGTYTFPTGAK.Y
Top scoring peptide matches to query 231
denisef28QSTAR.1321.3.3308.3308.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 234.74 to 234.74 min, Period: 1, Cycles(s): 3308 - 3308, Experiment 2 - 2
Score greater than 24 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 11.6        32   -0.0609   15   VIT1_DROME R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
Top scoring peptide matches to query 232
denisef28QSTAR.991.3.3313.3313.4.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 235.34 to 235.34 min, Period: 1, Cycles(s): 3313 - 3313, Experiment 2 - 2
Score greater than 23 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
 10.3        49    0.0074   15   VIT1_DROME R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
Top scoring peptide matches to query 233
denisef28QSTAR.1321.7.3328.3328.3.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 237.05 to 237.05 min, Period: 1, Cycles(s): 3328 - 3328, Experiment 1 - 1
Score greater than 17 indicates homology
Score greater than 39 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  4.2  1.8e+002    0.9582   15   VIT1_DROME R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
Top scoring peptide matches to query 234
denisef28QSTAR.991.5.3309.3309.4.mgf, Sample: denisef28QSTAR (sample number 1), Elution: 234.86 to 234.86 min, Period: 1, Cycles(s): 3309 - 3309, Experiment 2 - 2
Score greater than 14 indicates homology
Score greater than 40 indicates identity
Score    Expect     Delta  Hit  Protein     Peptide
  3.4  2.4e+002    1.0046   15   VIT1_DROME R.MDNSVNQALKPSQWLSGSQLEAIPALDDFTIER.L
  0.8  4.2e+002    1.0711                   K.LNGKVQDWTMPIICVNLWDHAYLHDYGVGNR.S
  0.5  4.6e+002    0.0186                   R.MEEMGYKDTDYNMGHLYDAFLKLADK.K
  0.5  4.6e+002    0.0186                   R.MEEMGYKDTDYNMGHLYDAFLKLADK.K
  0.5  4.6e+002    0.0186                   R.MEEMGYKDTDYNMGHLYDAFLKLADK.K
  0.5  4.6e+002    1.1143                   K.MEEMQQHNMSWIEVQFLKKAVDILCQCR.Q