MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 4218)

Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4179 616.3200 2461.2509 2461.1577 37.9 1 3 0.88 +1Score > 23 indicates identity
Score > 15 indicates homology		 EARAENPGMQASDMELANAILAK + 2 Oxidation (M)
4042 1175.1132 2348.2118 2348.2236 -5.03 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 NAGATRIWLLQAAPGQPLDAER + Deamidated (NQ)
4458 679.3561 3391.7441 3391.6496 27.9 0 3 0.58 +1Score > 21 indicates identity
Score > 13 indicates homology		 LMLGMNALVINTGTHLVLVDTGMGQSMGELSR + 2 Oxidation (M); 2 Deamidated (NQ)
4659 742.5943 3707.9351 3707.9783 -11.6 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 EAMVYANVIGCDLGPKITPIGSLATLLWLHVLAR + Oxidation (M); Deamidated (NQ)
2122 502.3371 501.3298 501.3275 4.70 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 IGKGK
3227 435.8879 1304.6419 1304.6361 4.45 1 3 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 SPEDVAADRAFK
4259 639.5519 2554.1785 2554.2924 -44.6 1 3 0.71 +1Score > 21 indicates identity
Score > 14 indicates homology		 MGFNCGIVGLPNVGKSTLFNALTK + Oxidation (M); Deamidated (NQ)
3405 497.5833 1489.7281 1489.6692 39.5 1 3 0.99 +1Score > 23 indicates identity
Score > 15 indicates homology		 SQRCGQGQQAGQGK + Deamidated (NQ)
2423 681.3301 680.3228 680.2952 40.7 0 3 2.2 +1Score > 18 indicates identity MNYPR + Deamidated (NQ)
2486 364.6835 727.3524 727.3864 -46.7 0 3 1.8 +1Score > 18 indicates identity QVAPADK
2781 497.2091 992.4036 992.4233 -19.8 0 3 1 +1Score > 15 indicates identity TATPNSMDR + Deamidated (NQ)
4507 1143.6207 3427.8403 3427.7578 24.0 0 3 2.7 +1Score > 19 indicates identity GLGEDVLAGIQTLNVGQGMEAGLAIVALAMVIDR + 2 Oxidation (M); 2 Deamidated (NQ)
2889 526.7362 1051.4578 1051.4492 8.26 0 3 2.8 +1Score > 20 indicates identity DSLQANGMAK + Oxidation (M); 2 Deamidated (NQ)
4134 811.0898 2430.2476 2430.1849 25.8 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 GIEFANADGSPAPAQLAKVMEAAR + Oxidation (M); Deamidated (NQ)
3178 634.8890 1267.7634 1267.7360 21.6 1 3 1.6 +1Score > 17 indicates identity IAQALAKPRGSR + Deamidated (NQ)
3026 574.2993 1146.5840 1146.5629 18.4 1 3 0.94 +1Score > 22 indicates identity
Score > 15 indicates homology		 NKVATTGDDAR
4061 787.7621 2360.2645 2360.1972 28.5 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 VGNTESAAVLLGEQVFDGLERR + Deamidated (NQ)
3173 634.2959 1266.5772 1266.5928 -12.3 1 3 0.88 +1Score > 21 indicates identity
Score > 14 indicates homology		 VGDFSGGWRMR
3757 684.0044 2048.9914 2048.8898 49.6 0 3 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 NNFQFYQAEMNASALER + Oxidation (M); Deamidated (NQ)
4097 797.3658 2389.0756 2389.1795 -43.5 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 VERLSAEVADSDLDNMLEVLR + Oxidation (M)
3422 377.4654 1505.8325 1505.7660 44.1 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LQVPPSMHAELER
4459 679.3572 3391.7496 3391.5826 49.2 1 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology		 MPADHPRPGIVHNDYRFDNVILDADNPMR + Oxidation (M); Deamidated (NQ)
2841 343.4710 1027.3912 1027.4388 -46.4 0 2 0.56 +1Score > 13 indicates identity MDMQVLMK + 2 Oxidation (M); Deamidated (NQ)
3028 1149.7003 1148.6930 1148.6852 6.80 0 2 0.71 +1Score > 13 indicates identity MKPIVLVGHR
3143 418.2632 1251.7678 1251.7299 30.3 1 2 0.89 +1Score > 14 indicates identity LRILDALPGER
4571 880.9670 3519.8389 3519.7304 30.8 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 NACTVDAVITVVDSPAVAAGTFAAYPDQVDAQRK
3599 587.6498 1759.9276 1759.9403 -7.22 0 2 0.88 +1Score > 22 indicates identity
Score > 14 indicates homology		 SLRPRPMIINAGEYK + Oxidation (M)
2600 421.2430 840.4714 840.4929 -25.6 1 2 2.3 +1Score > 19 indicates identity KGNIRPR + Deamidated (NQ)
2846 343.8151 1028.4235 1028.4168 6.48 0 2 0.92 +1Score > 15 indicates identity MTCGSGFGGR
3706 628.0070 1880.9992 1881.0796 -42.7 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 SQQAILAGLIGRGIQLSR + Deamidated (NQ)
3900 563.0292 2248.0877 2248.1964 -48.3 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 LGLRYDIRPDLQVYGNLSR + Deamidated (NQ)
4579 587.6509 3519.8617 3519.7308 37.2 0 2 0.81 +1Score > 20 indicates identity
Score > 14 indicates homology		 AEPAGPSVVVAMAVAALGYGIMNLLMIQASMHMK + 3 Oxidation (M); Deamidated (NQ)
4580 587.6540 3519.8803 3519.7308 42.5 0 2 2.8 +1Score > 19 indicates identity AEPAGPSVVVAMAVAALGYGIMNLLMIQASMHMK + 3 Oxidation (M); Deamidated (NQ)
3780 699.3688 2095.0846 2095.0698 7.04 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 FSGDYVAGLSGANGKALDVVR
3764 515.5273 2058.0801 2058.1006 -9.95 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 VLQGFAAGALPPMLMSVALR + Oxidation (M); Deamidated (NQ)
4239 837.7540 2510.2402 2510.2435 -1.32 0 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 VLGNTQVNALAGIRPQGPDCATVR + 4 Deamidated (NQ)
3802 535.7990 2139.1669 2139.0817 39.9 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 DVCVTFEISMSTVNRLLR
2575 819.4242 818.4169 818.4320 -18.4 0 2 0.72 +1Score > 22 indicates identity
Score > 13 indicates homology		 AMVDVLR + Oxidation (M)
3318 469.2595 1404.7567 1404.7435 9.37 0 2 0.78 +1Score > 21 indicates identity
Score > 14 indicates homology		 EVPLNTIIFMGR + Oxidation (M)
3356 718.4024 1434.7902 1434.7388 35.9 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 ELTTLLSLMNQR + Oxidation (M); Deamidated (NQ)
4478 852.4420 3405.7389 3405.7788 -11.7 1 2 0.67 +1Score > 22 indicates identity
Score > 13 indicates homology		 RFSSMALGISLLIPLGLVMANPTGNVYTANER + Deamidated (NQ)
3206 322.4079 1285.6025 1285.5721 23.7 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QAEALMHNSER + Deamidated (NQ)
3298 463.5703 1387.6891 1387.7096 -14.8 0 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 SPGEQANVVLFAR + Deamidated (NQ)
4690 635.0139 3804.0397 3803.8961 37.8 1 2 2.3 +1Score > 18 indicates identity NEMGLTNVEIMVPFVRTLGEASQVVDLLAENGLAR + Oxidation (M); 3 Deamidated (NQ)
2196 555.3141 554.3068 554.2812 46.2 0 2 1.1 +1Score > 15 indicates identity PNAPR + Deamidated (NQ)
4251 843.0726 2526.1960 2526.3119 -45.9 1 2 0.62 +1Score > 22 indicates identity
Score > 13 indicates homology		 TNAGIDQISTFTKLFVFSVPGER
4482 853.1887 3408.7257 3408.5887 40.2 1 2 0.85 +1Score > 21 indicates identity
Score > 14 indicates homology		 LPVAQMPEELAELASSMNAMLQRLDDAFQR + 2 Oxidation (M); 3 Deamidated (NQ)
2731 484.7314 967.4482 967.4359 12.8 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 GQAFSESSR
3410 747.8787 1493.7428 1493.7548 -8.00 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 SQYQGPILMLTAR + Oxidation (M); Deamidated (NQ)
2742 973.4094 972.4021 972.4270 -25.5 0 2 0.63 +1Score > 13 indicates identity NCVMVHGR + Deamidated (NQ)
3013 567.3553 1132.6960 1132.6604 31.4 0 2 0.63 +1Score > 13 indicates identity LLSFAGVIASR
4497 1141.2511 3420.7315 3420.6620 20.3 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 RQFDEGEEAFLVTMSAQLAGVIAHAEATGSIR + Oxidation (M); Deamidated (NQ)
3267 454.2621 1359.7645 1359.7874 -16.9 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LLGGPQAGIIVGHK + Deamidated (NQ)
3323 704.3912 1406.7678 1406.7517 11.5 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 ALQGLLHEEIER
3897 563.0279 2248.0825 2248.1335 -22.7 0 2 0.78 +1Score > 23 indicates identity
Score > 14 indicates homology		 HQIVALPGSDADEAQLVDTLR + Deamidated (NQ)
2830 511.3247 1020.6348 1020.6192 15.3 1 2 0.61 +1Score > 13 indicates identity VLHGQKLAR
4109 801.7552 2402.2438 2402.1965 19.7 0 2 0.68 +1Score > 22 indicates identity
Score > 13 indicates homology		 IGDSDNHVQLLEPLSPESPVQK + Deamidated (NQ)
3233 438.5108 1312.5106 1312.5275 -12.9 0 2 0.73 +1Score > 13 indicates identity DEMGQLQTSMR + Oxidation (M); 2 Deamidated (NQ)
3910 1131.0833 2260.1520 2260.1256 11.7 0 2 0.63 +1Score > 23 indicates identity
Score > 13 indicates homology		 MTEALNEALTNIQDNLTQIK + Deamidated (NQ)
3758 1025.5031 2048.9916 2048.8898 49.7 0 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 NNFQFYQAEMNASALER + Oxidation (M); Deamidated (NQ)
4082 792.1183 2373.3331 2373.2185 48.3 1 2 2.5 +1Score > 19 indicates identity LSMPRFDQAPVLVVGDVMLDR + Oxidation (M)
3957 1143.6010 2285.1874 2285.1337 23.5 1 2 0.9 +1Score > 22 indicates identity
Score > 14 indicates homology		 SQVAFFMQSLLAHLRFGGMK + Oxidation (M); 2 Deamidated (NQ)
4696 635.0167 3804.0565 3803.8961 42.2 1 2 2.1 +1Score > 18 indicates identity NEMGLTNVEIMVPFVRTLGEASQVVDLLAENGLAR + Oxidation (M); 3 Deamidated (NQ)
3544 854.3990 1706.7834 1706.8298 -27.1 0 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology		 LFLMADQDLQLGGGGR + Oxidation (M); Deamidated (NQ)
4515 859.6649 3434.6305 3434.7690 -40.3 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 DVAFGVTVAGRPVSMPQMQRTVGLFINSVALR + Oxidation (M); 3 Deamidated (NQ)
3210 431.1921 1290.5545 1290.5737 -14.9 0 2 2.2 +1Score > 18 indicates identity MTAFVCDYLR + Oxidation (M)
1249 375.1994 374.1921 374.1914 1.96 0 2 1 +1Score > 25 indicates identity
Score > 15 indicates homology		 GGGGK
2985 557.8340 1113.6534 1113.6255 25.1 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AVQVTVGERR
3543 569.9182 1706.7328 1706.8145 -47.9 1 2 2.6 +1Score > 19 indicates identity SCLQQRGEVQTALSK + 3 Deamidated (NQ)
4136 811.4222 2431.2448 2431.2900 -18.6 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QEFQVPFVSLILFGDNVAPVGR
3006 566.2493 1130.4840 1130.5067 -20.0 0 2 2 +1Score > 18 indicates identity ITFEGDFMR + Oxidation (M)
2911 533.3250 1064.6354 1064.5839 48.4 1 2 1.2 +1Score > 15 indicates identity QLQRHIDR
3595 877.4721 1752.9296 1752.8869 24.4 0 2 0.94 +1Score > 22 indicates identity
Score > 14 indicates homology		 QLSLQGVMPLFGYGSR + Deamidated (NQ)
3752 676.3503 2026.0291 2026.0371 -3.97 0 2 0.67 +1Score > 23 indicates identity
Score > 13 indicates homology		 EVQQLSEVGTGSLYTLFR
2612 425.2406 848.4666 848.4426 28.4 0 2 0.74 +1Score > 21 indicates identity
Score > 13 indicates homology		 LNTLTMR + Deamidated (NQ)
4110 601.5686 2402.2453 2402.1965 20.3 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 IGDSDNHVQLLEPLSPESPVQK + Deamidated (NQ)
2583 414.2715 826.5284 826.5025 31.4 0 2 2.7 +1Score > 19 indicates identity IAQLNLR
3727 649.3590 1945.0552 1945.0771 -11.3 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LLLEQLDGQLKATFLNK + 2 Deamidated (NQ)
2718 478.7467 955.4788 955.5015 -23.7 0 2 0.86 +1Score > 20 indicates identity
Score > 14 indicates homology		 WQVLPLAQ + 2 Deamidated (NQ)
3797 531.2764 2121.0765 2120.9767 47.1 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 DLQMPPPGMLLFGGMMVNR + Oxidation (M); 2 Deamidated (NQ)
4049 785.0449 2352.1129 2352.1242 -4.83 0 2 0.92 +1Score > 22 indicates identity
Score > 14 indicates homology		 DCLAYIDEVWTDMRPLSLR
3659 918.9583 1835.9020 1835.9200 -9.76 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VMPQVVDADHLRQAQK + 2 Deamidated (NQ)
3880 559.0328 2232.1021 2232.0732 12.9 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 ILDNAFLMSSSRNYIDSLR + Oxidation (M); 2 Deamidated (NQ)
2223 578.2822 577.2749 577.3006 -44.5 1 2 2.2 +1Score > 18 indicates identity AMKGR + Oxidation (M)
2845 343.8081 1028.4025 1028.4168 -13.9 0 2 0.65 +1Score > 13 indicates identity MTCGSGFGGR
3166 632.3596 1262.7046 1262.6475 45.3 1 2 0.81 +1Score > 20 indicates identity
Score > 13 indicates homology		 LLQRAMDMLR + Oxidation (M); Deamidated (NQ)
3726 973.5306 1945.0466 1945.0771 -15.7 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LLLEQLDGQLKATFLNK + 2 Deamidated (NQ)
4057 786.7700 2357.2882 2357.2301 24.6 0 2 0.68 +1Score > 22 indicates identity
Score > 13 indicates homology		 VLTSGAGASLVLLNTFSEIYMR + Oxidation (M)
4596 712.3646 3556.7866 3556.7542 9.13 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 HIGPRAADEQAMLTALGFDSLDAMTAAVIPDSIK + 2 Oxidation (M)
3835 440.0331 2195.1291 2195.1296 -0.22 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 MRVPFTELQSLLQAIFQR + Oxidation (M); 3 Deamidated (NQ)
4499 1141.9076 3422.7010 3422.6162 24.8 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 FTSNLFEDKPDLAQQLIDALQAWMGEMPGR + 2 Deamidated (NQ)
2541 798.4019 797.3946 797.4072 -15.7 0 2 2.6 +1Score > 18 indicates identity IAEYFR
4206 828.7496 2483.2270 2483.1386 35.6 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LLERQMVSHSQYDNAENLYR + Oxidation (M); 2 Deamidated (NQ)
3251 667.8658 1333.7170 1333.6990 13.5 1 2 0.92 +1Score > 22 indicates identity
Score > 14 indicates homology		 RQALLDDVFTR + Deamidated (NQ)
4395 996.8337 2987.4793 2987.3818 32.6 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 CEQILTYVEEAEAEASDAHARPAGQLK + 2 Deamidated (NQ)
4658 618.3316 3703.9459 3703.8363 29.6 1 2 0.83 +1Score > 20 indicates identity
Score > 13 indicates homology		 VVECGSFAAAANALDISAAQVSRIVAELENQLQTR + 3 Deamidated (NQ)
3299 694.8519 1387.6892 1387.6466 30.7 0 2 0.68 +1Score > 23 indicates identity
Score > 13 indicates homology		 LIENELNEEER + Deamidated (NQ)
3466 786.9236 1571.8326 1571.8267 3.78 1 2 0.79 +1Score > 22 indicates identity
Score > 13 indicates homology		 ELNVTQGAISRQVR + 2 Deamidated (NQ)
4424 1097.8351 3290.4835 3290.6129 -39.3 0 2 0.93 +1Score > 20 indicates identity
Score > 14 indicates homology		 MEAIGQLAGGVAHDFNNLLTSISGSFELIQR + 3 Deamidated (NQ)
3747 504.7532 2014.9837 2014.9531 15.2 0 2 0.93 +1Score > 23 indicates identity
Score > 14 indicates homology		 VHAQLAQPGTCGAGYNTLR + 2 Deamidated (NQ)
Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/