MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Andy2683a |
| MS data file | : | Andy2683a.mgf |
| Database | : | P-putida 20180924 (5,556 sequences; 1,892,173 residues) |
| Timestamp | : | 2 Aug 2026 at 00:54:18 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Oxidation (M), Deamidated (NQ) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 50 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | Default |
| Number of queries | : | 4,770 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3037 |
388.5333 | 1162.5781 | 1162.5982 | -17.3 | 1 | 8 | 0.58 | 1Score > 23 indicates identity Score > 18 indicates homology |
IEEFRAGVDK |
| 3535 |
568.9699 | 1703.8879 | 1703.8366 | 30.1 | 0 | 8 | 0.7 | 1Score > 23 indicates identity Score > 19 indicates homology |
SNTEWIAVLSADQLR + 2 Deamidated (NQ) |
| 3608 |
884.9504 | 1767.8862 | 1767.9155 | -16.6 | 1 | 8 | 0.63 | 1Score > 23 indicates identity Score > 18 indicates homology |
RDQAILELFYSSGLR + Deamidated (NQ) |
| 3894 |
1124.5447 | 2247.0748 | 2247.0664 | 3.76 | 1 | 8 | 0.82 | 1Score > 23 indicates identity Score > 20 indicates homology |
GSFMVIQDMTGRIQVYVNR + 2 Oxidation (M); 2 Deamidated (NQ) |
| 2795 |
502.2223 | 1002.4300 | 1002.4375 | -7.43 | 1 | 8 | 0.48 | 1Score > 17 indicates identity |
MNRTMYR + 2 Oxidation (M) |
| 3532 |
566.9570 | 1697.8492 | 1697.9312 | -48.3 | 0 | 8 | 0.59 | 1Score > 22 indicates identity Score > 18 indicates homology |
GQVLAVIASQQISDLR + Deamidated (NQ) |
| 2788 |
333.4844 | 997.4314 | 997.3845 | 47.0 | 0 | 8 | 0.49 | 1Score > 17 indicates identity |
MQGEQTMR + Oxidation (M); 2 Deamidated (NQ) |
| 2178 |
539.3312 | 538.3239 | 538.3227 | 2.23 | 0 | 8 | 0.49 | 1Score > 17 indicates identity |
IPGPR |
| 2363 |
647.3277 | 646.3204 | 646.3398 | -30.0 | 1 | 8 | 0.43 | 1Score > 23 indicates identity Score > 17 indicates homology |
SKEQR |
| 3169 |
422.5606 | 1264.6600 | 1264.6519 | 6.39 | 1 | 8 | 1 | 1Score > 22 indicates identity Score > 20 indicates homology |
ILSQRMMELK + Oxidation (M); Deamidated (NQ) |
| 3092 |
407.2159 | 1218.6259 | 1218.6608 | -28.7 | 0 | 8 | 0.84 | 1Score > 23 indicates identity Score > 20 indicates homology |
DSNLALIGFIR + Deamidated (NQ) |
| 2912 |
533.8052 | 1065.5958 | 1065.5679 | 26.2 | 1 | 8 | 0.35 | 1Score > 20 indicates identity Score > 16 indicates homology |
RDHLAEAVR |
| 2148 |
518.2947 | 517.2874 | 517.2860 | 2.76 | 0 | 8 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
LNSGK |
| 3072 |
602.3777 | 1202.7408 | 1202.7387 | 1.82 | 1 | 8 | 0.17 | 1Score > 13 indicates identity |
IQAYIKLQVK |
| 2435 |
689.3520 | 688.3447 | 688.3755 | -44.8 | 0 | 8 | 0.67 | 1Score > 23 indicates identity Score > 18 indicates homology |
LEVSNK |
| 3281 |
686.8690 | 1371.7234 | 1371.7048 | 13.6 | 1 | 8 | 0.97 | 1Score > 22 indicates identity Score > 20 indicates homology |
RYGGLLWGEHGK |
| 2222 |
576.2782 | 575.2709 | 575.2915 | -35.7 | 0 | 8 | 0.99 | 1Score > 20 indicates identity |
GGSLDK |
| 3691 |
931.9794 | 1861.9442 | 1862.0261 | -44.0 | 1 | 8 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
PVAPNPLLQANAIAKTSR + 2 Deamidated (NQ) |
| 4063 |
788.7155 | 2363.1247 | 2363.1977 | -30.9 | 1 | 8 | 0.93 | 1Score > 22 indicates identity Score > 20 indicates homology |
ADINLMVVFEALMQERNLTR + Deamidated (NQ) |
| 3665 |
615.9667 | 1844.8783 | 1844.8250 | 28.9 | 0 | 8 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
YIQAGDCYQINLTQR + 3 Deamidated (NQ) |
| 2180 |
539.3556 | 538.3483 | 538.3227 | 47.6 | 1 | 8 | 0.18 | 1Score > 13 indicates identity |
IKAAH |
| 3229 |
653.3395 | 1304.6644 | 1304.6282 | 27.8 | 0 | 8 | 0.24 | 1Score > 23 indicates identity Score > 14 indicates homology |
SEELLGEMLER |
| 2300 |
624.3482 | 623.3409 | 623.3503 | -15.1 | 0 | 8 | 0.31 | 1Score > 15 indicates identity |
LQHAR |
| 3417 |
750.9002 | 1499.7858 | 1499.7871 | -0.86 | 0 | 8 | 0.3 | 1Score > 23 indicates identity Score > 15 indicates homology |
IFPPATQAVLAEDK + Deamidated (NQ) |
| 2616 |
428.2509 | 854.4872 | 854.4610 | 30.7 | 0 | 7 | 0.55 | 1Score > 17 indicates identity |
QNQIGAPK |
| 4411 |
811.1904 | 3240.7325 | 3240.7176 | 4.61 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
RQAKPEHKPSLEELLEMLVEQALAVQPR + 2 Deamidated (NQ) |
| 2501 |
372.7167 | 743.4188 | 743.4177 | 1.51 | 0 | 7 | 0.44 | 1Score > 23 indicates identity Score > 16 indicates homology |
QINLQK + Deamidated (NQ) |
| 2736 |
486.2243 | 970.4340 | 970.4178 | 16.7 | 0 | 7 | 0.7 | 1Score > 18 indicates identity |
MNSTAQFR + Oxidation (M); Deamidated (NQ) |
| 3277 |
456.8983 | 1367.6731 | 1367.6681 | 3.65 | 1 | 7 | 0.65 | 1Score > 22 indicates identity Score > 18 indicates homology |
NHIDLDDLERK + Deamidated (NQ) |
| 2251 |
301.1936 | 600.3726 | 600.3707 | 3.20 | 1 | 7 | 0.61 | 1Score > 23 indicates identity Score > 18 indicates homology |
LGRQK |
| 2966 |
366.4949 | 1096.4629 | 1096.4785 | -14.3 | 0 | 7 | 0.47 | 1Score > 17 indicates identity |
QGGPDPASNPR + 2 Deamidated (NQ) |
| 3090 |
609.8223 | 1217.6300 | 1217.6186 | 9.37 | 1 | 7 | 0.27 | 1Score > 23 indicates identity Score > 14 indicates homology |
MPESVSLRQR + Oxidation (M) |
| 3070 |
401.2122 | 1200.6148 | 1200.5622 | 43.8 | 0 | 7 | 0.85 | 1Score > 23 indicates identity Score > 19 indicates homology |
LGEDAPNTDLR + Deamidated (NQ) |
| 3539 |
853.9675 | 1705.9204 | 1705.9363 | -9.27 | 0 | 7 | 0.69 | 1Score > 21 indicates identity Score > 18 indicates homology |
APQVELNLIPTAVQGR + Deamidated (NQ) |
| 3250 |
445.5795 | 1333.7167 | 1333.6626 | 40.5 | 0 | 7 | 1 | 1Score > 22 indicates identity Score > 20 indicates homology |
DAAGPGLSTYNLR |
| 2260 |
304.1823 | 606.3500 | 606.3489 | 1.83 | 0 | 7 | 0.89 | 1Score > 19 indicates identity |
FTLAR |
| 3140 |
625.7801 | 1249.5456 | 1249.5939 | -38.6 | 1 | 7 | 0.82 | 1Score > 19 indicates identity |
LYDPNKDETR |
| 4642 |
736.1953 | 3675.9401 | 3675.7760 | 44.7 | 1 | 7 | 1 | 1Score > 20 indicates identity Score > 20 indicates homology |
TFSPNLDQMTPEQLRALAAQALQLQSQVEAMSR + 4 Deamidated (NQ) |
| 2820 |
508.2487 | 1014.4828 | 1014.5094 | -26.2 | 0 | 7 | 1 | 1Score > 21 indicates identity Score > 20 indicates homology |
QDGNAELIR |
| 3021 |
570.8409 | 1139.6672 | 1139.6662 | 0.88 | 0 | 7 | 0.77 | 1Score > 19 indicates identity |
NVIVNGINIGK |
| 2786 |
498.7318 | 995.4490 | 995.4494 | -0.40 | 0 | 7 | 0.87 | 1Score > 19 indicates identity |
LMNDANFR + Oxidation (M) |
| 2555 |
405.7679 | 809.5212 | 809.5487 | -33.9 | 1 | 7 | 0.2 | 1Score > 13 indicates identity |
LAPILKR |
| 2947 |
544.2634 | 1086.5122 | 1086.5305 | -16.8 | 0 | 7 | 0.57 | 1Score > 21 indicates identity Score > 17 indicates homology |
LDNLAEQQR + Deamidated (NQ) |
| 1995 |
458.3090 | 457.3017 | 457.2900 | 25.6 | 0 | 7 | 0.31 | 1Score > 22 indicates identity Score > 15 indicates homology |
VLVAG |
| 2979 |
556.2896 | 1110.5646 | 1110.5570 | 6.87 | 0 | 7 | 0.41 | 1Score > 20 indicates identity Score > 16 indicates homology |
HEAVAPNAFR |
| 2449 |
701.3359 | 700.3286 | 700.3391 | -15.0 | 0 | 7 | 0.61 | 1Score > 17 indicates identity |
QPNVNK + 2 Deamidated (NQ) |
| 3333 |
356.6680 | 1422.6429 | 1422.6483 | -3.79 | 0 | 7 | 0.82 | 1Score > 20 indicates identity Score > 19 indicates homology |
QMSPMSAEATVVR + Oxidation (M); Deamidated (NQ) |
| 3074 |
605.3038 | 1208.5930 | 1208.6084 | -12.7 | 1 | 7 | 0.77 | 1Score > 22 indicates identity Score > 18 indicates homology |
HPAAGVVCDKR |
| 3193 |
427.2427 | 1278.7063 | 1278.6819 | 19.0 | 1 | 7 | 0.6 | 1Score > 20 indicates identity Score > 17 indicates homology |
ALAEIKADGTYK |
| 2177 |
539.3307 | 538.3234 | 538.3227 | 1.30 | 0 | 7 | 0.59 | 1Score > 17 indicates identity |
IPGPR |
| 4568 |
704.9743 | 3519.8351 | 3519.7308 | 29.7 | 0 | 7 | 0.94 | 1Score > 21 indicates identity Score > 19 indicates homology |
AEPAGPSVVVAMAVAALGYGIMNLLMIQASMHMK + 3 Oxidation (M); Deamidated (NQ) |
| 2473 |
359.2111 | 716.4076 | 716.3817 | 36.2 | 1 | 7 | 1 | 1Score > 24 indicates identity Score > 19 indicates homology |
IDKEGR |
| 2627 |
432.7222 | 863.4298 | 863.4613 | -36.4 | 1 | 7 | 0.91 | 1Score > 23 indicates identity Score > 19 indicates homology |
YQARGLR + Deamidated (NQ) |
| 3223 |
434.5549 | 1300.6429 | 1300.6623 | -14.9 | 1 | 7 | 0.33 | 1Score > 23 indicates identity Score > 15 indicates homology |
GQDLLQKNVER + 2 Deamidated (NQ) |
| 2760 |
491.2607 | 980.5068 | 980.5113 | -4.58 | 0 | 7 | 0.57 | 1Score > 20 indicates identity Score > 17 indicates homology |
FGGIATMLR + Oxidation (M) |
| 3204 |
643.8077 | 1285.6008 | 1285.6150 | -11.0 | 0 | 7 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
QLAEVDPESAAR + Deamidated (NQ) |
| 2662 |
455.2075 | 908.4004 | 908.3844 | 17.7 | 0 | 7 | 0.96 | 1Score > 19 indicates identity |
CMQLEGR + Oxidation (M) |
| 2667 |
459.2477 | 916.4808 | 916.4978 | -18.5 | 0 | 7 | 0.74 | 1Score > 24 indicates identity Score > 18 indicates homology |
VAELGSVSR |
| 3673 |
617.9976 | 1850.9710 | 1850.9097 | 33.1 | 1 | 7 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
AFRSMHNLLSEVFQR + Oxidation (M); Deamidated (NQ) |
| 2357 |
322.7094 | 643.4042 | 643.3765 | 43.1 | 1 | 7 | 0.3 | 1Score > 23 indicates identity Score > 14 indicates homology |
IERAR |
| 2633 |
435.7742 | 869.5338 | 869.5447 | -12.4 | 1 | 7 | 0.86 | 1Score > 19 indicates identity |
VLAGLNKR |
| 2831 |
341.8391 | 1022.4955 | 1022.4590 | 35.7 | 0 | 7 | 0.81 | 1Score > 21 indicates identity Score > 18 indicates homology |
ANMVDVTEK + Oxidation (M); Deamidated (NQ) |
| 3025 |
383.2008 | 1146.5806 | 1146.5629 | 15.4 | 1 | 7 | 0.81 | 1Score > 22 indicates identity Score > 18 indicates homology |
NKVATTGDDAR |
| 2360 |
647.3150 | 646.3077 | 646.3398 | -49.7 | 0 | 7 | 0.76 | 1Score > 22 indicates identity Score > 18 indicates homology |
ISQGSR |
| 2723 |
321.4948 | 961.4626 | 961.4393 | 24.2 | 0 | 7 | 0.93 | 1Score > 22 indicates identity Score > 19 indicates homology |
QWLQQGTV + 3 Deamidated (NQ) |
| 3666 |
923.4487 | 1844.8828 | 1844.8751 | 4.19 | 1 | 7 | 0.41 | 1Score > 23 indicates identity Score > 15 indicates homology |
EEAQETRAQIIEAAER + 2 Deamidated (NQ) |
| 3733 |
655.3571 | 1963.0495 | 1962.9759 | 37.5 | 1 | 7 | 1 | 1Score > 21 indicates identity Score > 19 indicates homology |
DGSGNVISAFQRDQTLVR + Deamidated (NQ) |
| 2871 |
1044.5862 | 1043.5789 | 1043.5400 | 37.3 | 0 | 7 | 1 | 1Score > 23 indicates identity Score > 19 indicates homology |
VAEVNGWLR + Deamidated (NQ) |
| 2514 |
383.2154 | 764.4162 | 764.4181 | -2.37 | 1 | 7 | 0.24 | 1Score > 21 indicates identity Score > 13 indicates homology |
LKYGER |
| 4036 |
781.4029 | 2341.1869 | 2341.2576 | -30.2 | 1 | 7 | 0.7 | 1Score > 23 indicates identity Score > 18 indicates homology |
LMLAGQDLGQISNAQIPFLRR + Deamidated (NQ) |
| 3407 |
374.1960 | 1492.7549 | 1492.7885 | -22.5 | 1 | 7 | 0.7 | 1Score > 23 indicates identity Score > 18 indicates homology |
KSVYATLEAGVQAR + Deamidated (NQ) |
| 3538 |
569.3007 | 1704.8803 | 1704.8219 | 34.2 | 1 | 7 | 0.32 | 1Score > 23 indicates identity Score > 14 indicates homology |
NWATAYNVPAVREGR + 2 Deamidated (NQ) |
| 3485 |
801.4374 | 1600.8602 | 1600.8177 | 26.5 | 1 | 7 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
VAEEMCRVVARPGK |
| 2680 |
467.7280 | 933.4414 | 933.4412 | 0.29 | 0 | 6 | 0.47 | 1Score > 22 indicates identity Score > 16 indicates homology |
MMLAQAPR + Oxidation (M); Deamidated (NQ) |
| 3568 |
864.4118 | 1726.8090 | 1726.8645 | -32.1 | 1 | 6 | 0.64 | 1Score > 21 indicates identity Score > 17 indicates homology |
CADSNALNRVRPAQR |
| 3908 |
1127.5530 | 2253.0914 | 2253.0558 | 15.8 | 0 | 6 | 0.41 | 1Score > 22 indicates identity Score > 15 indicates homology |
LMALQQAWNDFGNEMISLR + Oxidation (M); Deamidated (NQ) |
| 3922 |
454.6430 | 2268.1786 | 2268.0917 | 38.3 | 1 | 6 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
QQQLMVALDNRGHAAQDSIR + Oxidation (M); 2 Deamidated (NQ) |
| 3616 |
890.4640 | 1778.9134 | 1778.9825 | -38.8 | 1 | 6 | 1 | 1Score > 23 indicates identity Score > 19 indicates homology |
QPALLMVAGRGGVIEPR + Oxidation (M) |
| 3073 |
602.8402 | 1203.6658 | 1203.6281 | 31.3 | 1 | 6 | 0.36 | 1Score > 21 indicates identity Score > 14 indicates homology |
MQRDINIVAK + Oxidation (M); Deamidated (NQ) |
| 3324 |
469.9411 | 1406.8015 | 1406.7935 | 5.64 | 1 | 6 | 0.79 | 1Score > 18 indicates identity |
LVHFRLFGPHGK |
| 2861 |
346.1792 | 1035.5158 | 1035.5019 | 13.4 | 1 | 6 | 0.51 | 1Score > 22 indicates identity Score > 16 indicates homology |
MAKETNAVR + Oxidation (M); Deamidated (NQ) |
| 2819 |
338.4841 | 1012.4305 | 1012.4461 | -15.5 | 0 | 6 | 0.62 | 1Score > 17 indicates identity |
TTYTQQNR + 2 Deamidated (NQ) |
| 3396 |
739.9269 | 1477.8392 | 1477.7889 | 34.1 | 1 | 6 | 1.1 | 1Score > 19 indicates identity |
QVRGLYSNVDSLK |
| 2892 |
351.8653 | 1052.5741 | 1052.6203 | -43.9 | 1 | 6 | 0.66 | 1Score > 20 indicates identity Score > 17 indicates homology |
IGLRNARPR + Deamidated (NQ) |
| 2415 |
678.3945 | 677.3872 | 677.3643 | 33.9 | 1 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
MSIRR + Oxidation (M) |
| 2728 |
484.2714 | 966.5282 | 966.5208 | 7.68 | 0 | 6 | 1.1 | 1Score > 19 indicates identity |
IMQALTFK + Oxidation (M) |
| 4310 |
665.5834 | 2658.3045 | 2658.2926 | 4.49 | 0 | 6 | 0.35 | 1Score > 23 indicates identity Score > 14 indicates homology |
WIDDINETQNTVVNFPIIADADR |
| 3588 |
582.9757 | 1745.9053 | 1745.9200 | -8.42 | 1 | 6 | 0.26 | 1Score > 23 indicates identity Score > 13 indicates homology |
EAKVFIVSPADGATVDK |
| 3018 |
379.8624 | 1136.5654 | 1136.5760 | -9.39 | 1 | 6 | 0.86 | 1Score > 21 indicates identity Score > 18 indicates homology |
RTYIGSMPGR |
| 3528 |
848.4434 | 1694.8722 | 1694.8331 | 23.1 | 1 | 6 | 0.59 | 1Score > 22 indicates identity Score > 16 indicates homology |
GVAVNSNIIKTMMER + 2 Oxidation (M); Deamidated (NQ) |
| 3425 |
504.5955 | 1510.7647 | 1510.7238 | 27.0 | 1 | 6 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
EPMELFVDFRGR + Oxidation (M) |
| 3603 |
441.4763 | 1761.8761 | 1761.8567 | 11.0 | 0 | 6 | 0.6 | 1Score > 23 indicates identity Score > 16 indicates homology |
QLLGISQMTDDALGER + Oxidation (M) |
| 3645 |
910.4761 | 1818.9376 | 1818.9112 | 14.6 | 1 | 6 | 1 | 1Score > 23 indicates identity Score > 19 indicates homology |
LEQVTGLNLFEREGGR + 2 Deamidated (NQ) |
| 2166 |
534.2559 | 533.2486 | 533.2333 | 28.8 | 0 | 6 | 1 | 1Score > 21 indicates identity Score > 19 indicates homology |
LAQSD + Deamidated (NQ) |
| 2730 |
323.4895 | 967.4467 | 967.4103 | 37.6 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 19 indicates homology |
CGSEMQLK + Oxidation (M) |
| 3181 |
635.8229 | 1269.6312 | 1269.6564 | -19.8 | 0 | 6 | 0.95 | 1Score > 22 indicates identity Score > 18 indicates homology |
AGNIQSVNPAGLK + 2 Deamidated (NQ) |
| 2532 |
393.7008 | 785.3870 | 785.3894 | -3.02 | 0 | 6 | 0.8 | 1Score > 18 indicates identity |
VMYFAR |
| 2792 |
334.1395 | 999.3967 | 999.4232 | -26.6 | 0 | 6 | 0.26 | 1Score > 13 indicates identity |
SYNMAGWR + Oxidation (M) |
| 3100 |
307.8991 | 1227.5673 | 1227.5774 | -8.21 | 1 | 6 | 0.91 | 1Score > 20 indicates identity Score > 18 indicates homology |
KVMMGQMISR + 3 Oxidation (M) |
| 3442 |
384.7230 | 1534.8629 | 1534.7991 | 41.6 | 0 | 6 | 0.51 | 1Score > 21 indicates identity Score > 16 indicates homology |
GLTPEQGQHVLDLK + Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/