MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4218)

Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3086 405.8757 1214.6053 1214.6230 -14.6 0 14 0.4 +1Score > 23 indicates identity HPMAFVALSAR + Oxidation (M)
2971 550.2682 1098.5218 1098.5305 -7.89 0 14 0.2 +1Score > 20 indicates identity HSQLQQLSR + 3 Deamidated (NQ)
3305 697.3779 1392.7412 1392.6820 42.6 1 14 0.13 +1Score > 21 indicates identity
Score > 18 indicates homology		 WVMGESSAKNLR + Oxidation (M)
2513 765.3546 764.3473 764.3123 45.8 0 14 0.26 +1Score > 21 indicates identity MVNNDR + Oxidation (M); Deamidated (NQ)
3010 566.2999 1130.5852 1130.5567 25.2 0 14 0.46 +1Score > 23 indicates identity LNIDAGGVQSR + 2 Deamidated (NQ)
4466 849.1888 3392.7261 3392.6195 31.4 0 14 0.3 +1Score > 21 indicates identity NACTVDAVITVVDSPAVAAGTFAAYPDQVDAQR + Deamidated (NQ)
3363 725.8903 1449.7660 1449.8303 -44.3 0 14 0.18 +1Score > 22 indicates identity
Score > 19 indicates homology		 LTHLANQLLSLAR + Deamidated (NQ)
2784 497.7709 993.5272 993.5356 -8.36 1 14 0.075 +1Score > 21 indicates identity
Score > 15 indicates homology		 ALIQARGAGH + Deamidated (NQ)
3320 704.3458 1406.6770 1406.6976 -14.6 1 14 0.39 +1Score > 22 indicates identity REVPTYVMQQR + Deamidated (NQ)
3113 617.3687 1232.7228 1232.6666 45.6 1 14 0.14 +1Score > 18 indicates identity DWLAGFLKQR
3044 390.1978 1167.5716 1167.5520 16.8 0 14 0.13 +1Score > 21 indicates identity
Score > 17 indicates homology		 NHQNLIQAAR + 4 Deamidated (NQ)
2878 523.2988 1044.5830 1044.6001 -16.4 0 14 0.2 +1Score > 22 indicates identity
Score > 19 indicates homology		 ITNVQVIMK
3334 712.3289 1422.6432 1422.6925 -34.6 1 14 0.28 +1Score > 20 indicates identity REVPTYVMQQR + Oxidation (M); Deamidated (NQ)
2438 348.2195 694.4244 694.4238 0.89 1 14 0.076 +1Score > 15 indicates identity IPPRGR
2316 316.6615 631.3084 631.3289 -32.4 0 13 0.57 +1Score > 24 indicates identity LTEGGR
2808 505.2302 1008.4458 1008.4222 23.4 0 13 0.2 +1Score > 19 indicates identity ELDMGDWK + Oxidation (M)
2997 561.3045 1120.5944 1120.5877 6.04 0 13 0.36 +1Score > 21 indicates identity SVGFLSQVER
2313 315.7007 629.3868 629.3748 19.1 0 13 0.61 +1Score > 24 indicates identity TAPLTK
2629 434.2116 866.4086 866.4102 -1.81 1 13 0.28 +1Score > 20 indicates identity MIRMER + 2 Oxidation (M)
2497 372.2307 742.4468 742.4589 -16.2 0 13 0.38 +1Score > 23 indicates identity
Score > 22 indicates homology		 QIELIK
2538 398.6908 795.3670 795.3698 -3.40 0 13 0.18 +1Score > 18 indicates identity MHIDHK + Oxidation (M)
2563 407.7625 813.5104 813.4821 34.9 1 13 0.39 +1Score > 22 indicates identity LADRIAR
2865 519.7886 1037.5626 1037.5869 -23.4 1 13 0.26 +1Score > 20 indicates identity ILPQGEPKR + Deamidated (NQ)
2835 513.8214 1025.6282 1025.5982 29.3 0 13 0.15 +1Score > 17 indicates identity IGVIGGGQLGR
3462 783.4014 1564.7882 1564.7919 -2.35 1 13 0.25 +1Score > 22 indicates identity
Score > 20 indicates homology		 DLLFRDDTVCLAK
2907 532.2788 1062.5430 1062.5393 3.56 0 13 0.43 +1Score > 22 indicates identity MALDIHAHR
3309 699.3557 1396.6968 1396.6582 27.6 0 13 0.14 +1Score > 22 indicates identity
Score > 17 indicates homology		 EHAGLTNEELQR + Deamidated (NQ)
2650 446.7549 891.4952 891.4913 4.43 0 13 0.36 +1Score > 21 indicates identity IIQTSTTK + Deamidated (NQ)
3454 774.4189 1546.8232 1546.8103 8.35 0 13 0.45 +1Score > 22 indicates identity GELEGADPLLHQLR
2929 541.2854 1080.5562 1080.5056 46.9 1 13 0.32 +1Score > 21 indicates identity RMVEMLNR + 2 Oxidation (M); Deamidated (NQ)
2416 339.7019 677.3892 677.3973 -11.9 0 13 0.11 +1Score > 20 indicates identity
Score > 16 indicates homology		 LGPVHR
2504 374.7274 747.4402 747.4313 12.0 0 13 0.14 +1Score > 17 indicates identity LLSLMR + Oxidation (M)
2406 672.3678 671.3605 671.3490 17.2 0 13 0.3 +1Score > 20 indicates identity QPQVAK + 2 Deamidated (NQ)
2638 878.3998 877.3925 877.4328 -45.9 0 13 0.35 +1Score > 21 indicates identity MDLGITGR + Oxidation (M)
2091 489.2434 488.2361 488.2343 3.77 0 13 0.5 +1Score > 22 indicates identity AAGNR + Deamidated (NQ)
2283 618.3361 617.3288 617.3133 25.2 0 13 0.83 +1Score > 24 indicates identity GQSVAR + Deamidated (NQ)
2485 727.4737 726.4664 726.4752 -12.1 0 13 0.12 +1Score > 16 indicates identity LGLAVVR
2548 403.2131 804.4116 804.4494 -46.9 0 13 0.43 +1Score > 21 indicates identity DFVAVVR
2450 351.6826 701.3506 701.3530 -3.39 0 12 0.41 +1Score > 24 indicates identity
Score > 21 indicates homology		 LEMPGR
3531 425.2190 1696.8469 1696.7805 39.2 0 12 0.55 +1Score > 23 indicates identity
Score > 22 indicates homology		 QSLVWHQNNLNNAR + 4 Deamidated (NQ)
2456 352.1918 702.3690 702.3660 4.28 0 12 0.87 +1Score > 24 indicates identity TAVEGAR
2704 474.7494 947.4842 947.4607 24.9 1 12 0.52 +1Score > 22 indicates identity MNRNELR + Oxidation (M)
2711 477.7171 953.4196 953.4389 -20.2 1 12 0.23 +1Score > 18 indicates identity DFNKMGAR + Oxidation (M)
2145 516.3150 515.3077 515.3180 -19.9 1 12 1 +1Score > 25 indicates identity
Score > 25 indicates homology		 GKGVR
3607 882.9796 1763.9446 1763.8811 36.0 1 12 0.46 +1Score > 21 indicates identity AIETIACGAPRTAFMR
3183 424.2180 1269.6322 1269.6830 -40.0 1 12 0.35 +1Score > 22 indicates identity
Score > 20 indicates homology		 LESWRQGPLGK
2214 572.2933 571.2860 571.2853 1.25 0 12 0.15 +1Score > 16 indicates identity LLNNP + 2 Deamidated (NQ)
2282 618.3147 617.3074 617.3020 8.76 0 12 0.28 +1Score > 24 indicates identity
Score > 19 indicates homology		 EINNK + Deamidated (NQ)
3089 609.8094 1217.6042 1217.6074 -2.57 0 12 0.74 +1Score > 23 indicates identity MELQNLLNSR + Deamidated (NQ)
3177 423.5950 1267.7632 1267.7612 1.57 1 12 0.18 +1Score > 17 indicates identity GIRLQLAAGQLK + Deamidated (NQ)
2617 855.4948 854.4875 854.4861 1.61 0 12 0.2 +1Score > 17 indicates identity EVPAAIQK
3085 607.8431 1213.6716 1213.6666 4.15 1 12 0.35 +1Score > 22 indicates identity
Score > 20 indicates homology		 EINGLKNELGK
2395 664.3417 663.3344 663.3340 0.62 0 12 0.54 +1Score > 22 indicates identity FNLDR
2602 421.7543 841.4940 841.4844 11.5 0 12 0.43 +1Score > 21 indicates identity ACLPLLR
4388 590.7036 2948.4816 2948.4655 5.48 0 12 0.49 +1Score > 21 indicates identity IELPDTVSQAQLPALQPGWSAQPELTR + 4 Deamidated (NQ)
2470 716.3694 715.3621 715.3653 -4.46 0 12 0.71 +1Score > 23 indicates identity FPPEAR
3575 870.4503 1738.8860 1738.8149 40.9 0 12 0.11 +1Score > 22 indicates identity
Score > 15 indicates homology		 AQTETLYQEVLDAQK + 3 Deamidated (NQ)
3533 567.9705 1700.8897 1700.8944 -2.80 0 12 0.68 +1Score > 23 indicates identity SSNNIVQLIESDILR + Deamidated (NQ)
2505 749.3583 748.3510 748.3351 21.2 0 12 0.61 +1Score > 22 indicates identity TEATDGR
2618 855.5009 854.4936 854.4861 8.75 0 12 0.23 +1Score > 18 indicates identity EVPAAIQK
3705 628.0049 1880.9929 1881.0796 -46.1 1 12 0.6 +1Score > 22 indicates identity SQQAILAGLIGRGIQLSR + Deamidated (NQ)
2568 815.5363 814.5290 814.4912 46.4 0 12 0.18 +1Score > 17 indicates identity LLVVSQR + Deamidated (NQ)
2560 407.6906 813.3666 813.3981 -38.6 0 12 0.15 +1Score > 16 indicates identity LQPGDQR + Deamidated (NQ)
2176 539.3303 538.3230 538.3227 0.56 0 12 0.21 +1Score > 17 indicates identity IPGPR
2218 573.3383 572.3310 572.3282 4.93 0 12 0.54 +1Score > 25 indicates identity
Score > 21 indicates homology		 GIEVR
2771 495.7379 989.4612 989.4665 -5.35 0 12 0.24 +1Score > 21 indicates identity
Score > 18 indicates homology		 IEDTDQLR + Deamidated (NQ)
2125 504.2787 503.2714 503.2591 24.5 0 11 0.087 +1Score > 25 indicates identity
Score > 13 indicates homology		 LSNIG + Deamidated (NQ)
2326 317.6702 633.3258 633.3082 27.9 0 11 0.55 +1Score > 21 indicates identity SNSGLR + Deamidated (NQ)
2964 548.3000 1094.5854 1094.6196 -31.2 0 11 0.42 +1Score > 20 indicates identity VAISTHSKPR
3343 716.3839 1430.7532 1430.7154 26.5 0 11 0.12 +1Score > 23 indicates identity
Score > 15 indicates homology		 SLNAPLADSTTWR
3049 589.8120 1177.6094 1177.6013 6.96 0 11 0.67 +1Score > 22 indicates identity LLDSSVQMIR + Oxidation (M); Deamidated (NQ)
2926 541.2579 1080.5012 1080.5312 -27.7 0 11 0.41 +1Score > 20 indicates identity NQAHAGAAAAAK + Deamidated (NQ)
3239 659.3594 1316.7042 1316.6837 15.6 0 11 0.84 +1Score > 23 indicates identity AWGQNLSLATTR
2238 594.2880 593.2807 593.2591 36.4 0 11 0.19 +1Score > 16 indicates identity MNASR + Oxidation (M)
3871 743.3814 2227.1224 2227.0599 28.0 1 11 0.69 +1Score > 22 indicates identity MALTVNTNITSMSVQKNLNK + Oxidation (M); 5 Deamidated (NQ)
3156 630.3159 1258.6172 1258.6266 -7.40 1 11 0.65 +1Score > 22 indicates identity
Score > 22 indicates homology		 LDAGSRDGEALR
3208 645.3606 1288.7066 1288.6888 13.9 1 11 0.13 +1Score > 22 indicates identity
Score > 15 indicates homology		 RDAVGVPFTATR
2719 478.7561 955.4976 955.5087 -11.5 1 11 0.44 +1Score > 20 indicates identity ARDAVPQAK + Deamidated (NQ)
3306 465.2546 1392.7420 1392.6820 43.1 1 11 0.11 +1Score > 21 indicates identity
Score > 14 indicates homology		 WVMGESSAKNLR + Oxidation (M)
3541 854.3727 1706.7308 1706.8145 -49.0 1 11 0.32 +1Score > 19 indicates identity SCLQQRGEVQTALSK + 3 Deamidated (NQ)
3275 683.3738 1364.7330 1364.7711 -27.9 1 11 0.63 +1Score > 21 indicates identity LVGHSPAMLRLR + Oxidation (M)
3472 528.2687 1581.7843 1581.8038 -12.4 0 11 0.31 +1Score > 22 indicates identity
Score > 18 indicates homology		 TFLEQNLQVYGLR + 2 Deamidated (NQ)
3020 570.3444 1138.6742 1138.6281 40.6 0 11 0.29 +1Score > 18 indicates identity LMQHLIAAAR + Oxidation (M)
3381 735.9062 1469.7978 1469.7660 21.6 0 11 0.65 +1Score > 22 indicates identity ACQLPGVELLASGR
2090 489.2423 488.2350 488.2343 1.52 0 11 0.57 +1Score > 21 indicates identity AAGNR + Deamidated (NQ)
2737 486.3244 970.6342 970.5923 43.2 1 11 0.084 +1Score > 13 indicates identity RLLVVSQR + Deamidated (NQ)
3087 405.8763 1214.6071 1214.6506 -35.9 0 11 0.52 +1Score > 23 indicates identity
Score > 20 indicates homology		 DVQQILALSAR + 2 Deamidated (NQ)
2652 448.2477 894.4808 894.5035 -25.4 1 11 0.38 +1Score > 19 indicates identity RDAPPLAR
2645 445.2410 888.4674 888.4301 42.0 0 11 0.1 +1Score > 23 indicates identity
Score > 13 indicates homology		 TLDQQER
2809 505.2935 1008.5724 1008.5716 0.83 0 11 0.34 +1Score > 18 indicates identity LTHLADALR
2876 523.2806 1044.5466 1044.5200 25.5 0 11 0.33 +1Score > 23 indicates identity
Score > 18 indicates homology		 DGQLVQGATR + Deamidated (NQ)
3172 633.8065 1265.5984 1265.5757 17.9 1 11 0.67 +1Score > 22 indicates identity
Score > 21 indicates homology		 RLGTAWCSCR
3817 722.6877 2165.0413 2165.0860 -20.7 0 11 0.86 +1Score > 22 indicates identity MQAMLGLYQSEEGVLQIVR + Deamidated (NQ)
3697 625.6765 1874.0077 1873.9641 23.2 0 11 0.73 +1Score > 22 indicates identity MISPQSIAVACAATGLVGK + Deamidated (NQ)
2259 304.1639 606.3132 606.3159 -4.40 0 11 0.75 +1Score > 22 indicates identity MTLAR + Oxidation (M)
4234 837.0622 2508.1648 2508.1227 16.8 1 10 0.23 +1Score > 22 indicates identity
Score > 17 indicates homology		 GDYQESWQPQAMSPKALAESQR + 2 Deamidated (NQ)
3317 703.3714 1404.7282 1404.7395 -7.99 1 10 0.77 +1Score > 22 indicates identity
Score > 22 indicates homology		 VAVERSEMSILR + Oxidation (M)
2368 325.6671 649.3196 649.3217 -3.21 0 10 0.48 +1Score > 21 indicates identity
Score > 20 indicates homology		 ALGMSR + Oxidation (M)
4027 780.7565 2339.2477 2339.2559 -3.50 0 10 0.18 +1Score > 21 indicates identity
Score > 15 indicates homology		 LPEEATQIYLGMPAPLAVAALR + Oxidation (M)
2946 363.1777 1086.5113 1086.5305 -17.7 0 10 0.4 +1Score > 21 indicates identity
Score > 19 indicates homology		 DDVAAAALNAR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/