MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 901–1000 (out of 4218)

Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3644 606.9911 1817.9515 1817.8997 28.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LLALFPAVMCYWYR + Oxidation (M)
3677 464.0063 1851.9961 1851.9802 8.57 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 LPQQLSGGQLQRANIAR + 3 Deamidated (NQ)
4327 671.0637 2680.2257 2680.1307 35.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 EQAGGDATENFEDVGHSTDAREMSK
4694 635.0153 3804.0481 3803.8961 40.0 1 0 3.7 +1Score > 18 indicates identity NEMGLTNVEIMVPFVRTLGEASQVVDLLAENGLAR + Oxidation (M); 3 Deamidated (NQ)
2481 723.3801 722.3728 722.3381 48.1 0 0 4.6 +1Score > 19 indicates identity AAMSTAR + Oxidation (M)
2765 328.8157 983.4253 983.4131 12.4 0 0 2.8 +1Score > 17 indicates identity TNYGQNMR + Deamidated (NQ)
4047 1176.5702 2351.1258 2351.1593 -14.2 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 SLDLARYPMGWVVAAGAHQHR + Oxidation (M); Deamidated (NQ)
4674 753.7979 3763.9531 3763.8376 30.7 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QCLRLDLSFAWDNRPAAAGDDLNLALDYASVSAR
4630 735.9958 3674.9426 3674.7919 41.0 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 TFSPNLDQMTPEQLRALAAQALQLQSQVEAMSR + 3 Deamidated (NQ)
3737 661.6754 1982.0044 1981.9302 37.4 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LLFERDDIAEQAQTMGK + Oxidation (M); 2 Deamidated (NQ)
2273 308.6647 615.3148 615.2976 28.0 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 NTQPR + Deamidated (NQ)
3142 626.8911 1251.7676 1251.7187 39.1 0 0 1.5 +1Score > 14 indicates identity LLLNSIGPNSPK
3765 687.0343 2058.0811 2058.0891 -3.92 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ALLAGNDSMALGAVSAVRAAGK + Oxidation (M)
1 300.0847 299.0774
2 300.1503 299.1430
3 300.1503 299.1430
4 300.1507 299.1434
5 300.1581 299.1508
6 300.1813 299.1740
7 301.0604 300.0531
8 301.0968 300.0895
9 301.1048 300.0975
10 301.1053 300.0980
11 301.1269 300.1196
12 301.1284 300.1211
13 301.1420 300.1347
14 301.1422 300.1349
15 301.1422 300.1349
16 301.1423 300.1350
17 301.1424 300.1351
18 301.1425 300.1352
19 301.1434 300.1361
20 301.1625 300.1552
21 301.1627 300.1554
22 301.1635 300.1562
23 301.1637 300.1564
24 301.1867 300.1794
25 301.2882 300.2809
26 302.1603 301.1530
27 302.1964 301.1891
28 302.1965 301.1892
29 302.2345 301.2272
30 302.8695 301.8622
31 303.0395 302.0322
32 303.0843 302.0770
33 303.0844 302.0771
34 303.1024 302.0951
35 303.1208 302.1135
36 303.1210 302.1137
37 303.1211 302.1138
38 303.1211 302.1138
39 303.1211 302.1138
40 303.1212 302.1139
41 303.1214 302.1141
42 303.1216 302.1143
43 303.1217 302.1144
44 303.1219 302.1146
45 303.1223 302.1150
46 303.1573 302.1500
47 303.1578 302.1505
48 303.1582 302.1509
49 303.1582 302.1509
50 303.1591 302.1518
51 303.1592 302.1519
52 303.1711 302.1638
53 303.1778 302.1705
54 303.1786 302.1713
55 304.0659 303.0586
56 304.1391 303.1318
57 304.1619 303.1546
58 304.1758 303.1685
59 304.1758 303.1685
60 304.1763 303.1690
61 304.9719 303.9646
62 305.0037 303.9964
63 305.0330 304.0257
64 305.0997 304.0924
65 305.0998 304.0925
66 305.1000 304.0927
67 305.1001 304.0928
68 305.1002 304.0929
69 305.1006 304.0933
70 305.1008 304.0935
71 305.1022 304.0949
72 305.1363 304.1290
73 305.1363 304.1290
74 305.1364 304.1291
75 305.1364 304.1291
76 305.1364 304.1291
77 305.1364 304.1291
78 305.1364 304.1291
79 305.1367 304.1294
80 305.1368 304.1295
81 305.1369 304.1296
82 305.1369 304.1296
83 305.1369 304.1296
84 305.1370 304.1297
85 305.1370 304.1297
86 305.1371 304.1298
87 305.1374 304.1301
Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/