MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 81–90 (out of 105)


Page: Previous 1 4 5 6 7 8 9 10 11 Next 

-81

Accession Score Description
1 RL7_PSEPK 23 50S ribosomal protein L7/L12 OS=Pseudomonas putida (strain KT2440) GN=rplL PE=3 SV=2
Score Mass Matches Sequences emPAI
81.1 RL7_PSEPK 23 12592 1 (1) 1 (1) 0.27
50S ribosomal protein L7/L12 OS=Pseudomonas putida (strain KT2440) GN=rplL PE=3 SV=2

-1 peptide matches (1 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
4719   1016.5256 4062.0733 4062.0143 14.5 1 23 0.009 +1Score > 20 indicates identity
Score > 15 indicates homology
U K.AMEETFGVTAAVAAAGPAAAAAVVEEQTEFNVVLVEAGDKK.V + Deamidated (NQ)

+82

Accession Score Description
1 Q88QZ7_PSEPK 23 Sensory box protein OS=Pseudomonas putida (strain KT2440) GN=PP_0337 PE=4 SV=1

+83

Accession Score Description
1 RPOB_PSEPK 22 DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain KT2440) GN=rpoB PE=3 SV=1

+84

Accession Score Description
1 Q88F84_PSEPK 22 Aminotransferase, class V OS=Pseudomonas putida (strain KT2440) GN=PP_4214 PE=3 SV=1

+85

Accession Score Description
1 Q88NE9_PSEPK 22 Fusaric acid resistance protein, putative OS=Pseudomonas putida (strain KT2440) GN=PP_1263 PE=3 SV=1

+86

Accession Score Description
1 Q88IZ2_PSEPK 22 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_2857 PE=4 SV=1

+87

Accession Score Description
1 Q88J56_PSEPK 22 description

+88

Accession Score Description
1 PDXH_PSEPK 22 Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Pseudomonas putida (strain KT2440) GN=pdxH PE=3 SV=1

+89

Accession Score Description
1 A0A1Q2SRM5_STRLA 21 Indigoidine synthase OS=Streptomyces lavendulae OX=1914 GN=lbpA PE=4 SV=1

+90

Accession Score Description
1 Q88NS1_PSEPK 21 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_1134 PE=4 SV=1
Page: Previous 1 4 5 6 7 8 9 10 11 Next 

Not what you expected? Try the select summary.