MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 105)


Page: 1 2 3 4 5 6  11 Next 

+1

Accession Score Description
1 3FLAG_TEV_PP_2683 7938 Fusion_protein_N_term_3FLAGTEV_in_frame_with_PP_2683

-2

Accession Score Description
1 Q88JG7_PSEPK 1226 Alcohol dehydrogenase, iron-containing OS=Pseudomonas putida (strain KT2440) GN=PP_2682 PE=4 SV=1
Score Mass Matches Sequences emPAI
2.1 Q88JG7_PSEPK 1226 41896 41 (34) 24 (21) 12.26
Alcohol dehydrogenase, iron-containing OS=Pseudomonas putida (strain KT2440) GN=PP_2682 PE=4 SV=1

-41 peptide matches (40 non-duplicate, 1 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
2193   551.2957 550.2884 550.2863 3.78 0 9 0.55 +1Score > 19 indicates identity U K.TFGAR.K
2321   634.2952 633.2879 633.2904 -3.97 0 5 2.1 +8Score > 20 indicates identity U R.QICGR.L + Deamidated (NQ)
2420 +1 340.7029 679.3912 679.3905 1.14 0 18 0.042 +1Score > 17 indicates identity U K.FSIVSK.A
2666   458.7362 915.4578 915.4562 1.76 0 63 3.6e-006 +1Score > 23 indicates identity
Score > 21 indicates homology
U R.HNVANYAK.T
2713   319.1816 954.5230 954.5208 2.25 1 20 0.049 +1Score > 20 indicates identity
Score > 19 indicates homology
U R.MKFSIVSK.A + Oxidation (M)
2714   478.2693 954.5240 954.5208 3.37 1 58 8.6e-006 +1Score > 20 indicates identity U R.MKFSIVSK.A + Oxidation (M)
2779   331.5386 991.5940 991.5927 1.29 0 46 5e-005 +1Score > 16 indicates identity U K.AIGIVVAHGR.S
2780   496.8044 991.5942 991.5927 1.56 0 65 5.7e-007 +1Score > 16 indicates identity U K.AIGIVVAHGR.S
2859   345.8908 1034.6506 1034.6488 1.72 0 46 2.6e-005 +1Score > 13 indicates identity U R.LVEHLIALK.R
2860   518.3333 1034.6520 1034.6488 3.15 0 40 0.00011 +1Score > 13 indicates identity U R.LVEHLIALK.R
2961   1093.5432 1092.5359 1092.5339 1.85 0 28 0.011 +1Score > 21 indicates identity
Score > 21 indicates homology
U R.DVEVVYGEAL.-
2962   547.2759 1092.5372 1092.5339 3.06 0 17 0.16 +1Score > 21 indicates identity U R.DVEVVYGEAL.-
3064   596.3832 1190.7518 1190.7499 1.64 1 47 2.1e-005 +1Score > 13 indicates identity U R.LVEHLIALKR.A
3065   397.9246 1190.7520 1190.7499 1.75 1 42 5.8e-005 +1Score > 13 indicates identity U R.LVEHLIALKR.A
3192   639.8306 1277.6466 1277.6438 2.22 0 82 6.5e-008 +1Score > 23 indicates identity U K.VIAEVFGIDCR.G
3337   712.8585 1423.7024 1423.7017 0.53 0 87 1.4e-008 +1Score > 22 indicates identity U R.VEEVMLGAEIYR.Q + Oxidation (M)
3338   712.8588 1423.7030 1423.7017 0.94 0 63 4.3e-006 +1Score > 22 indicates identity U R.SILEFEGVDMIR.V + Oxidation (M)
3339   475.5750 1423.7032 1423.7017 1.04 0 2 2.2 +10Score > 22 indicates identity
Score > 18 indicates homology
U R.VEEVMLGAEIYR.Q + Oxidation (M)
3364   484.9160 1451.7262 1451.7231 2.10 0 25 0.0048 +1Score > 23 indicates identity
Score > 15 indicates homology
U K.FVSPEIIFGAGCR.H
3365   726.8706 1451.7266 1451.7231 2.42 0 73 4.7e-007 +1Score > 22 indicates identity U K.FVSPEIIFGAGCR.H
3419   753.9139 1505.8132 1505.8103 1.96 0 53 4e-005 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3420   377.4609 1505.8145 1505.8103 2.78 0 51 6.8e-005 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3421   502.9456 1505.8150 1505.8103 3.10 0 55 2.8e-005 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3456   518.6110 1552.8112 1552.8072 2.56 1 51 3e-005 +1Score > 22 indicates identity
Score > 19 indicates homology
U R.FKVIAEVFGIDCR.G
3468   790.9191 1579.8236 1579.8181 3.52 1 57 1.8e-005 +1Score > 22 indicates identity U R.KFVSPEIIFGAGCR.H
3469   527.6153 1579.8241 1579.8181 3.79 1 34 0.0034 +1Score > 22 indicates identity U R.KFVSPEIIFGAGCR.H
3776   695.3818 2083.1236 2083.0983 12.1 0 78 1.2e-007 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); Deamidated (NQ)
3777   1042.5693 2083.1240 2083.0983 12.4 0 114 2.8e-011 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); Deamidated (NQ)
3778   1043.0612 2084.1078 2084.0823 12.3 0 104 3.4e-010 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3779   695.7100 2084.1082 2084.0823 12.4 0 77 7.2e-008 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3782   1050.9550 2099.8954 2099.9187 -11.1 0 1 2.6 +1Score > 18 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A
3792   706.6477 2116.9213 2116.8976 11.2 0 49 6.4e-005 +1Score > 20 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Oxidation (M); Deamidated (NQ)
4032   781.0936 2340.2590 2340.2358 9.88 1 51 1.7e-005 +1Score > 21 indicates identity
Score > 16 indicates homology
U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); Deamidated (NQ)
4038   781.4172 2341.2298 2341.2198 4.24 1 70 8.7e-007 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); 2 Deamidated (NQ)
4256   849.0685 2544.1837 2544.1625 8.33 0 59 9.5e-006 +1Score > 21 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Oxidation (M); Deamidated (NQ)
4421   820.7001 3278.7713 3278.7398 9.60 0 43 0.00026 +1Score > 19 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
4422   1094.2637 3279.7693 3279.7238 13.9 0 46 0.00011 +1Score > 19 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + 2 Deamidated (NQ)
4721   1083.5686 4330.2453 4330.1831 14.4 1 33 0.0022 +1Score > 19 indicates identity U R.KVLVVSDPGVIAAGWVADVEASLQAQGIDYCLYTAVSPNPR.V + 2 Deamidated (NQ)
4747   1172.3788 4685.4861 4685.4150 15.2 1 15 0.088 +1Score > 17 indicates identity U R.SILEFEGVDMIRVPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Oxidation (M); 2 Deamidated (NQ)
D:\Xcalibur\Data\Jennifer\PRT1487 Andy\Andy2683a.raw

Score > 17 indicates identity

4764   1005.5019 6026.9677 6026.9104 9.52 0 26 0.0062 -1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
9.52 0 20 0.026 2 K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
9.52 0 9 0.35 3 K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
9.52 0 9 0.38 4 K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)

+3

Accession Score Description
1 TRYP_PIG 210 Trypsin OS=Sus scrofa PE=1 SV=1

+4

Accession Score Description
1 CH60_PSEPK 142 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1

+5

Accession Score Description
1 Q88M80_PSEPK 82 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_1694 PE=4 SV=1

+6

Accession Score Description
1 RS4_PSEPK 69 30S ribosomal protein S4 OS=Pseudomonas putida (strain KT2440) GN=rpsD PE=3 SV=1

+7

Accession Score Description
1 Q88I44_PSEPK 60 Inositol monophosphatase family protein OS=Pseudomonas putida (strain KT2440) GN=PP_3157 PE=4 SV=1

+8

Accession Score Description
1 Q88IY0_PSEPK 50 Oxidoreductase, FMN-binding OS=Pseudomonas putida (strain KT2440) GN=PP_2869 PE=4 SV=1

+9

Accession Score Description
Family member distances as a dendrogram 1 Q88JT1_PSEPK 46 Leucine-rich repeat domain protein OS=Pseudomonas putida (strain KT2440) GN=PP_2566 PE=4 SV=1
2 Q88BY3_PSEPK 38 Transposition protein, TnsC-related protein OS=Pseudomonas putida (strain KT2440) GN=PP_5404 PE=4 SV=1

+10

Accession Score Description
1 Q88L42_PSEPK 44 Response regulator NasT OS=Pseudomonas putida (strain KT2440) GN=nasT PE=4 SV=1
Page: 1 2 3 4 5 6  11 Next 

Not what you expected? Try the select summary.