MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2683a
MS data file : Andy2683a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:54:18 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,770

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 105)


Page: 1 2 3 4 5 6  11 Next 

-1

Accession Score Description
1 3FLAG_TEV_PP_2683 7938 Fusion_protein_N_term_3FLAGTEV_in_frame_with_PP_2683
Score Mass Matches Sequences emPAI
1.1 3FLAG_TEV_PP_2683 7938 66327 301 (265) 62 (55) 559.31
Fusion_protein_N_term_3FLAGTEV_in_frame_with_PP_2683
3 samesets of 3FLAG_TEV_PP_2683
6HIS_TEV_PP_2683 7938 64438 301 (265) 62 (55) 671.54
Fusion_protein_N_term_6HISTEV_in_frame_with_PP_2683
Q88JG6_PSEPK 7938 62885 301 (265) 62 (55) 787.03
Sensory box histidine kinase/response regulator OS=Pseudomonas putida (strain KT2440) GN=PP_2683 PE=4 SV=1
JBx_206305 7938 66500 301 (265) 62 (55) 553.50
alt_start_1

-301 peptide matches (156 non-duplicate, 145 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
2270   308.1832 614.3518 614.3500 3.02 0 12 0.46 +1Score > 21 indicates identity
Score > 21 indicates homology
K.LAQQR.L
2285   618.3369 617.3296 617.3285 1.76 0 30 0.017 +1Score > 24 indicates identity U R.SWLGR.G
2286 +1 309.6721 617.3296 617.3285 1.80 0 21 0.12 +4Score > 24 indicates identity U R.SWLGR.G
2289 +1 311.1893 620.3640 620.3646 -0.85 0 32 0.0017 +1Score > 17 indicates identity U K.ILGYR.I
2291   621.3730 620.3657 620.3646 1.85 0 31 0.0021 +1Score > 17 indicates identity U K.ILGYR.I
2349   642.4304 641.4231 641.4224 1.09 0 32 0.0014 +1Score > 16 indicates identity U R.ILLGAR.R
2351 +3 321.7190 641.4234 641.4224 1.60 0 36 0.00051 +1Score > 16 indicates identity U R.ILLGAR.R
2386   659.3491 658.3418 658.3398 3.03 0 22 0.053 +1Score > 22 indicates identity U R.GIAQDR.L
2387 +2 330.1783 658.3420 658.3398 3.37 0 44 0.00033 +1Score > 22 indicates identity U R.GIAQDR.L
2438 +1 348.2195 694.4244 694.3987 37.1 1 6 0.45 +2Score > 15 indicates identity U R.RGGHLR.L
2498 +1 372.2311 742.4476 742.4449 3.64 1 25 0.035 +1Score > 23 indicates identity U R.KLAQQR.L
2506   754.3389 753.3316 753.3293 3.07 0 1 2.2 +1Score > 17 indicates identity U R.YTEEGR.I
2508 +1 377.6738 753.3330 753.3293 4.96 0 23 0.015 +1Score > 17 indicates identity U R.YTEEGR.I
2528 +1 783.4487 782.4414 782.4398 2.01 0 43 0.00021 +1Score > 18 indicates identity U R.AANPALAR.M
2529 +3 392.2282 782.4418 782.4398 2.55 0 51 3.2e-005 +1Score > 18 indicates identity U R.AANPALAR.M
2565 +3 408.2706 814.5266 814.5276 -1.19 0 43 0.00012 +1Score > 17 indicates identity U R.LLISTLR.E
2566 +1 815.5359 814.5286 814.5276 1.24 0 28 0.0041 +1Score > 17 indicates identity U R.LLISTLR.E
2572   817.3826 816.3753 816.3726 3.39 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
U R.DAAEAANR.S
2573 +1 409.1951 816.3756 816.3726 3.78 0 35 0.0021 +1Score > 21 indicates identity U R.DAAEAANR.S
2679   311.8681 932.5825 932.5807 1.90 1 27 0.0043 +1Score > 16 indicates identity U R.IAKILGYR.I
2698 +2 473.7461 945.4776 945.4767 1.00 0 52 7.2e-005 +1Score > 23 indicates identity U R.TDELLEAR.D
2700 +1 946.4854 945.4781 945.4767 1.51 0 53 5.3e-005 +1Score > 23 indicates identity U R.TDELLEAR.D
2746   974.4813 973.4740 973.4716 2.49 0 61 9.5e-006 +1Score > 23 indicates identity U R.LDELEAER.N
2747 +2 487.7444 973.4742 973.4716 2.72 0 66 2.7e-006 +1Score > 23 indicates identity U R.LDELEAER.N
2750 +2 488.2484 974.4822 974.4821 0.10 0 61 9.3e-006 +1Score > 23 indicates identity U R.LEVWDTGR.G
2751   975.4905 974.4832 974.4821 1.11 0 60 9.8e-006 +1Score > 23 indicates identity U R.LEVWDTGR.G
2758   981.4602 980.4529 980.4498 3.20 0 45 0.0002 +1Score > 20 indicates identity U R.NFLSNACR.Y
2759   491.2345 980.4544 980.4498 4.76 0 42 0.00044 +1Score > 20 indicates identity U R.NFLSNACR.Y
2761   491.7234 981.4322 981.4338 -1.57 0 29 0.0054 +1Score > 19 indicates identity U R.NFLSNACR.Y + Deamidated (NQ)
2762   491.7243 981.4340 981.4338 0.26 0 48 7.9e-005 +1Score > 19 indicates identity U R.NFLSNACR.Y + Deamidated (NQ)
2837   1027.5902 1026.5829 1026.5822 0.74 0 63 3.4e-006 +1Score > 21 indicates identity U R.EGALLALQGR.A
2839 +2 514.2996 1026.5846 1026.5822 2.41 0 69 9e-007 +1Score > 21 indicates identity U R.EGALLALQGR.A
2895   1059.5228 1058.5155 1058.5145 0.99 0 30 0.0079 +1Score > 22 indicates identity
Score > 22 indicates homology
U K.SHYPELSAR.L
2897 +2 530.2658 1058.5170 1058.5145 2.43 0 35 0.0014 +1Score > 22 indicates identity
Score > 19 indicates homology
U K.SHYPELSAR.L
2899 +1 353.8469 1058.5189 1058.5145 4.15 0 34 0.0034 +1Score > 22 indicates identity U K.SHYPELSAR.L
2935   1083.6538 1082.6465 1082.6448 1.60 0 71 3.1e-007 +1Score > 18 indicates identity U K.GVGLGLAIVER.I
2937 +7 542.3315 1082.6484 1082.6448 3.38 0 76 8.7e-008 +1Score > 18 indicates identity U K.GVGLGLAIVER.I
2952 +1 1092.6791 1091.6718 1091.6703 1.42 0 52 7.8e-006 +1Score > 13 indicates identity U R.AVLSQLLLVH.-
2954   364.8980 1091.6722 1091.6703 1.74 0 29 0.0016 +1Score > 13 indicates identity U R.AVLSQLLLVH.-
2957 +6 546.8449 1091.6752 1091.6703 4.56 0 62 6e-007 +1Score > 13 indicates identity U R.AVLSQLLLVH.-
2992   373.5620 1117.6642 1117.6608 3.06 1 16 0.083 +1Score > 18 indicates identity U K.ILGYRIEVR.S
2993 +1 559.8394 1117.6642 1117.6608 3.13 1 36 0.00098 +1Score > 18 indicates identity U K.ILGYRIEVR.S
3053 +3 396.5441 1186.6105 1186.6094 0.87 1 54 4.3e-005 +1Score > 23 indicates identity U R.KSHYPELSAR.L
3056 +1 594.3134 1186.6122 1186.6094 2.37 1 39 0.0016 +1Score > 23 indicates identity U R.KSHYPELSAR.L
3080 +2 404.5880 1210.7422 1210.7397 2.00 1 54 7.7e-006 +1Score > 16 indicates identity U R.KGVGLGLAIVER.I
3081 +1 606.3785 1210.7424 1210.7397 2.23 1 90 2e-009 +1Score > 16 indicates identity U R.KGVGLGLAIVER.I
3098 +2 410.1935 1227.5587 1227.5632 -3.71 0 43 0.00024 +1Score > 19 indicates identity U R.EHSLHGYETR.L
3102 +1 614.7911 1227.5676 1227.5632 3.60 0 35 0.0018 +1Score > 20 indicates identity U R.EHSLHGYETR.L
3108 +4 616.8480 1231.6814 1231.6812 0.17 0 51 1.8e-005 +1Score > 22 indicates identity
Score > 16 indicates homology
U R.GSVFSIEVPLGK.E
3114 +4 619.3241 1236.6336 1236.6350 -1.09 0 82 5.4e-008 +1Score > 22 indicates identity U R.IADYAISTDLR.L
3129 +2 415.5461 1243.6165 1243.6156 0.68 1 23 0.042 +1Score > 23 indicates identity
Score > 22 indicates homology
U R.LDELEAERNR.Y
3132 +2 622.8220 1243.6294 1243.6156 11.1 1 37 0.0021 +1Score > 23 indicates identity U R.LDELEAERNR.Y
3259 +2 675.8790 1349.7434 1349.7415 1.42 0 84 2.2e-008 +1Score > 20 indicates identity U R.ALAGLLGLGDHSAR.K
3262 +3 450.9224 1349.7454 1349.7415 2.85 0 65 1.8e-006 +1Score > 20 indicates identity U R.ALAGLLGLGDHSAR.K
3271   681.4368 1360.8590 1360.8554 2.65 1 38 0.00016 +1Score > 13 indicates identity U K.LRAVLSQLLLVH.-
3272   454.6270 1360.8592 1360.8554 2.74 1 46 2.4e-005 +1Score > 13 indicates identity U K.LRAVLSQLLLVH.-
3273   455.2487 1362.7243 1362.7190 3.86 1 13 0.086 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.ILRNFLSNACR.Y
3289 +5 693.3552 1384.6958 1384.6946 0.88 0 79 1.1e-007 +1Score > 22 indicates identity
Score > 22 indicates homology
U R.LQQLNDELEQR.V
3292 +1 462.5732 1384.6978 1384.6946 2.27 0 53 4.3e-005 +1Score > 22 indicates identity U R.LQQLNDELEQR.V
3296   462.9004 1385.6794 1385.6786 0.53 0 56 2.3e-005 +1Score > 23 indicates identity U R.LQQLNDELEQR.V + Deamidated (NQ)
3297   693.8485 1385.6824 1385.6786 2.75 0 67 2.3e-006 +1Score > 23 indicates identity U R.LQQLNDELEQR.V + Deamidated (NQ)
3308   465.9623 1394.8651 1394.8609 2.98 1 40 0.00012 +1Score > 13 indicates identity U K.GVGLGLAIVERIAK.I
3346   716.4564 1430.8982 1430.8973 0.67 0 74 3.6e-008 +1Score > 13 indicates identity U K.LGAPLLNKPVKPGK.L
3348 +2 477.9735 1430.8987 1430.8973 0.96 0 51 7.3e-006 +1Score > 13 indicates identity U K.LGAPLLNKPVKPGK.L
3350 +3 358.7321 1430.8993 1430.8973 1.40 0 37 0.00021 +1Score > 13 indicates identity U K.LGAPLLNKPVKPGK.L
3354   478.3060 1431.8962 1431.8813 10.4 0 27 0.0018 +1Score > 13 indicates identity U K.LGAPLLNKPVKPGK.L + Deamidated (NQ)
3393   739.9258 1477.8370 1477.8365 0.38 1 66 1.1e-006 +1Score > 19 indicates identity U R.ALAGLLGLGDHSARK.S
3394 +1 493.6198 1477.8376 1477.8365 0.73 1 43 0.00025 +1Score > 19 indicates identity U R.ALAGLLGLGDHSARK.S
3398 +1 370.4674 1477.8405 1477.8365 2.71 1 40 0.0005 +1Score > 19 indicates identity U R.ALAGLLGLGDHSARK.S
3411   748.3948 1494.7750 1494.7692 3.94 1 61 5.6e-006 +1Score > 22 indicates identity
Score > 21 indicates homology
U R.GGHLRLEVWDTGR.G
3412   374.7012 1494.7757 1494.7692 4.37 1 27 0.016 +1Score > 22 indicates identity U R.GGHLRLEVWDTGR.G
3413   499.2668 1494.7786 1494.7692 6.29 1 46 0.00023 +1Score > 22 indicates identity U R.GGHLRLEVWDTGR.G
3448 +1 772.9252 1543.8358 1543.8358 0.011 0 76 2.1e-007 +1Score > 22 indicates identity U R.LDQAAVKPDVAVYR.L
3452 +3 515.6204 1543.8394 1543.8358 2.29 0 84 3.5e-008 +1Score > 22 indicates identity U R.LDQAAVKPDVAVYR.L
3511   837.4522 1672.8898 1672.8896 0.13 0 73 5.1e-007 +1Score > 22 indicates identity U R.ERPLPEAEHVLVER.T
3515 +3 419.2301 1672.8913 1672.8896 0.99 0 67 7.8e-007 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.ERPLPEAEHVLVER.T
3518 +3 558.6395 1672.8967 1672.8896 4.21 0 61 6.8e-006 +1Score > 22 indicates identity U R.ERPLPEAEHVLVER.T
3561 +1 862.9709 1723.9272 1723.9257 0.90 0 59 5.8e-006 +1Score > 22 indicates identity
Score > 19 indicates homology
U R.EHFATAIPAVIITADR.S
3562   575.6497 1723.9273 1723.9257 0.91 0 56 8.1e-006 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.EHFATAIPAVIITADR.S
3580   872.9265 1743.8384 1743.8387 -0.14 1 22 0.015 +1Score > 23 indicates identity
Score > 16 indicates homology
U R.TDELLEARDAAEAANR.S
3581 +1 582.2873 1743.8401 1743.8387 0.79 1 46 0.00028 +1Score > 23 indicates identity U R.TDELLEARDAAEAANR.S
3627 +3 903.9721 1805.9296 1805.9312 -0.86 0 86 1.4e-008 +1Score > 23 indicates identity
Score > 20 indicates homology
U R.LQDIFLEFNQLDVGR.A
3632 +2 602.9872 1805.9398 1805.9312 4.75 0 88 1.1e-008 +1Score > 22 indicates identity
Score > 21 indicates homology
U R.LQDIFLEFNQLDVGR.A
3635   603.3149 1806.9229 1806.9152 4.24 0 67 1.6e-006 +1Score > 23 indicates identity
Score > 22 indicates homology
U R.LQDIFLEFNQLDVGR.A + Deamidated (NQ)
3638 +1 603.3195 1806.9367 1806.9152 11.9 0 98 1.6e-009 +1Score > 22 indicates identity U R.LQDIFLEFNQLDVGR.A + Deamidated (NQ)
3639 +2 904.4772 1806.9398 1806.9152 13.6 0 84 3.8e-008 +1Score > 22 indicates identity U R.LQDIFLEFNQLDVGR.A + Deamidated (NQ)
3640   904.4800 1806.9454 1806.9152 16.7 0 55 9.8e-006 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.LQDIFLEFNQLDVGR.A + Deamidated (NQ)
3647   912.4921 1822.9696 1822.9689 0.39 0 116 2.1e-011 +1Score > 21 indicates identity U K.YLAAASHDLLQPLNAAR.L
3648   608.6645 1822.9717 1822.9689 1.50 0 62 4.6e-006 +1Score > 21 indicates identity U K.YLAAASHDLLQPLNAAR.L
3649   912.9924 1823.9702 1823.9529 9.49 0 67 1.4e-006 +1Score > 21 indicates identity U K.YLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3650   609.0005 1823.9797 1823.9529 14.7 0 27 0.0033 +1Score > 21 indicates identity
Score > 15 indicates homology
U K.YLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3651   913.4874 1824.9602 1824.9370 12.8 0 90 9.9e-009 +1Score > 22 indicates identity U K.YLAAASHDLLQPLNAAR.L + 2 Deamidated (NQ)
3652   609.3278 1824.9616 1824.9370 13.5 0 43 0.00039 +1Score > 22 indicates identity
Score > 21 indicates homology
U K.YLAAASHDLLQPLNAAR.L + 2 Deamidated (NQ)
3746   672.3342 2013.9808 2013.9755 2.61 1 26 0.027 +1Score > 23 indicates identity U K.SHYPELSARLDELEAER.N
3766   517.7809 2067.0945 2067.0748 9.51 1 32 0.005 +1Score > 21 indicates identity U K.DKYLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3767 +1 690.0388 2067.0946 2067.0748 9.54 1 73 4e-007 +1Score > 21 indicates identity U K.DKYLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3768   1034.5555 2067.0964 2067.0748 10.5 1 96 2.1e-009 +1Score > 21 indicates identity U K.DKYLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3770   517.7830 2067.1029 2067.0748 13.6 1 31 0.0018 +1Score > 21 indicates identity
Score > 16 indicates homology
U K.DKYLAAASHDLLQPLNAAR.L + Deamidated (NQ)
3771   690.3687 2068.0843 2068.0589 12.3 1 57 5e-006 +1Score > 22 indicates identity
Score > 16 indicates homology
U K.DKYLAAASHDLLQPLNAAR.L + 2 Deamidated (NQ)
3772   518.0289 2068.0865 2068.0589 13.4 1 32 0.0061 +1Score > 22 indicates identity U K.DKYLAAASHDLLQPLNAAR.L + 2 Deamidated (NQ)
3809   540.0512 2156.1757 2156.1742 0.70 1 8 0.19 +1Score > 20 indicates identity
Score > 13 indicates homology
U R.YLREHFATAIPAVIITADR.S
3845 +7 737.7164 2210.1274 2210.1066 9.39 0 79 1.2e-007 +1Score > 22 indicates identity U R.THQALEGAEDLLTDLLDISR.L + Deamidated (NQ)
3848   553.5404 2210.1325 2210.1066 11.7 0 57 1.8e-005 +1Score > 22 indicates identity U R.THQALEGAEDLLTDLLDISR.L + Deamidated (NQ)
3851 +2 1106.0757 2210.1368 2210.1066 13.7 0 100 1e-009 +1Score > 22 indicates identity U R.THQALEGAEDLLTDLLDISR.L + Deamidated (NQ)
3902 +2 750.4216 2248.2430 2248.2216 9.52 0 66 1.5e-006 +1Score > 20 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGR.R + Deamidated (NQ)
3903   1125.1296 2248.2446 2248.2216 10.3 0 56 1.3e-005 +1Score > 20 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGR.R + Deamidated (NQ)
3905   563.0688 2248.2461 2248.2216 10.9 0 23 0.029 +1Score > 20 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGR.R + Deamidated (NQ)
3982   768.4175 2302.2307 2302.2096 9.14 0 18 0.14 +1Score > 22 indicates identity U R.LDELFAPLVSEFSPVAEAAGLK.L
4019   779.3824 2335.1254 2335.1055 8.49 0 25 0.03 +1Score > 22 indicates identity U K.WLFENAVHGIFQASLQDGMR.A + Oxidation (M); Deamidated (NQ)
4020   1168.5723 2335.1300 2335.1055 10.5 0 56 2.4e-005 +1Score > 22 indicates identity U K.WLFENAVHGIFQASLQDGMR.A + Oxidation (M); Deamidated (NQ)
4021   584.7908 2335.1341 2335.1055 12.2 0 38 0.0013 +1Score > 22 indicates identity U K.WLFENAVHGIFQASLQDGMR.A + Oxidation (M); Deamidated (NQ)
4023   779.7147 2336.1223 2336.0896 14.0 0 31 0.0069 +1Score > 22 indicates identity U K.WLFENAVHGIFQASLQDGMR.A + Oxidation (M); 2 Deamidated (NQ)
4073   593.8024 2371.1805 2371.1590 9.05 1 15 0.3 +1Score > 22 indicates identity U R.EHFATAIPAVIITADRSDQCR.R + Deamidated (NQ)
4074   791.4008 2371.1806 2371.1590 9.09 1 6 1 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.EHFATAIPAVIITADRSDQCR.R + Deamidated (NQ)
4113   481.6762 2403.3446 2403.3387 2.48 1 14 0.14 +1Score > 18 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGRR.L
4114 -1 601.8437 2403.3457 2403.3387 2.92 1 26 0.0087 +1Score > 18 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGRR.L
4112   601.8148 2403.2301 2403.3387 -45.2 1 (22) 0.057 +1Score > 22 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGRR.L
4118 +3 602.0934 2404.3445 2404.3227 9.07 1 23 0.022 +1Score > 19 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGRR.L + Deamidated (NQ)
4119 +1 802.4555 2404.3447 2404.3227 9.15 1 27 0.0089 +1Score > 19 indicates identity U K.EVPLAVHQAVPLPSVGDPLPGRR.L + Deamidated (NQ)
4155   816.4296 2446.2670 2446.2605 2.66 1 52 3.6e-005 +1Score > 22 indicates identity
Score > 20 indicates homology
U R.GIAQDRLQDIFLEFNQLDVGR.A
4158 +1 816.7627 2447.2663 2447.2445 8.91 1 67 1.8e-006 +1Score > 22 indicates identity U R.GIAQDRLQDIFLEFNQLDVGR.A + Deamidated (NQ)
4159   612.8245 2447.2689 2447.2445 9.98 1 31 0.0078 +1Score > 22 indicates identity U R.GIAQDRLQDIFLEFNQLDVGR.A + Deamidated (NQ)
4162 +4 816.7672 2447.2798 2447.2445 14.4 1 69 7.7e-007 +1Score > 22 indicates identity
Score > 20 indicates homology
U R.GIAQDRLQDIFLEFNQLDVGR.A + Deamidated (NQ)
4275   657.3247 2625.2697 2625.2798 -3.85 1 6 1 +1Score > 22 indicates identity
Score > 19 indicates homology
U R.YKWLFENAVHGIFQASLQDGMR.A + Oxidation (M)
4276   876.4360 2626.2862 2626.2638 8.51 1 35 0.0029 +1Score > 22 indicates identity U R.YKWLFENAVHGIFQASLQDGMR.A + Oxidation (M); Deamidated (NQ)
4277   657.5798 2626.2901 2626.2638 10.0 1 41 0.00074 +1Score > 22 indicates identity U R.YKWLFENAVHGIFQASLQDGMR.A + Oxidation (M); Deamidated (NQ)
4365   927.5068 2779.4986 2779.4908 2.79 1 3 2.4 +1Score > 19 indicates identity U R.LDELFAPLVSEFSPVAEAAGLKLHAR.I
4436 +1 675.7536 3373.7316 3373.7340 -0.71 0 11 0.62 +1Score > 21 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K
4437   844.4412 3373.7357 3373.7340 0.50 0 51 5.3e-005 +1Score > 21 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K
4439   1125.5887 3373.7443 3373.7340 3.04 0 8 1 +1Score > 21 indicates identity
Score > 21 indicates homology
U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K
4440 +1 844.6864 3374.7165 3374.7180 -0.46 0 53 3.8e-005 +1Score > 21 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Deamidated (NQ)
4446   1130.9250 3389.7532 3389.6734 23.5 0 29 0.0028 +1Score > 22 indicates identity
Score > 16 indicates homology
U R.LLVLDNEVSILESMGALLGQWGCEVVTATDR.E + 2 Deamidated (NQ)
4451 +5 848.6942 3390.7477 3390.7130 10.2 0 99 6.4e-010 +1Score > 22 indicates identity
Score > 19 indicates homology
U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Oxidation (M); Deamidated (NQ)
4452 +3 679.1573 3390.7501 3390.7130 11.0 0 31 0.0016 +1Score > 21 indicates identity
Score > 15 indicates homology
U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Oxidation (M); Deamidated (NQ)
4472 +1 852.1890 3404.7269 3404.6844 12.5 0 80 3.6e-008 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.LLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); Deamidated (NQ)
4473 +1 1135.9175 3404.7307 3404.6844 13.6 0 98 9.6e-010 +1Score > 22 indicates identity
Score > 20 indicates homology
U R.LLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); Deamidated (NQ)
4476   852.4368 3405.7181 3405.6684 14.6 0 51 6.6e-005 +1Score > 22 indicates identity U R.LLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); 2 Deamidated (NQ)
4477   1136.2533 3405.7381 3405.6684 20.5 0 42 0.00023 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.LLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); 2 Deamidated (NQ)
4547   866.4879 3461.9225 3461.8923 8.73 1 27 0.0045 +1Score > 16 indicates identity U R.GSVFSIEVPLGKEVPLAVHQAVPLPSVGDPLPGR.R + Deamidated (NQ)
4554   876.4605 3501.8129 3501.8290 -4.59 1 32 0.0042 +1Score > 21 indicates identity U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K
4555   701.3728 3501.8276 3501.8290 -0.39 1 21 0.015 +1Score > 21 indicates identity
Score > 15 indicates homology
U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K
4556   701.5717 3502.8221 3502.8130 2.61 1 28 0.0035 +1Score > 21 indicates identity
Score > 16 indicates homology
U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Deamidated (NQ)
4559   1173.9518 3518.8336 3518.8079 7.29 1 29 0.0088 +1Score > 21 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITERK.L + Oxidation (M); Deamidated (NQ)
4560 +1 880.7161 3518.8353 3518.8079 7.78 1 78 9.8e-008 +1Score > 21 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITERK.L + Oxidation (M); Deamidated (NQ)
4561 +2 704.7750 3518.8386 3518.8079 8.73 1 47 6.8e-005 +1Score > 21 indicates identity
Score > 18 indicates homology
U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Oxidation (M); Deamidated (NQ)
4562   587.4816 3518.8459 3518.8079 10.8 1 7 0.46 +1Score > 21 indicates identity
Score > 16 indicates homology
U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Oxidation (M); Deamidated (NQ)
4564   587.4825 3518.8513 3518.8079 12.3 1 16 0.14 +1Score > 20 indicates identity U K.DGSHLDVLMNLLLKPGHEGLVEGFVADITERK.L + Oxidation (M); Deamidated (NQ)
4565   880.7212 3518.8557 3518.8079 13.6 1 7 1 +1Score > 20 indicates identity
Score > 19 indicates homology
U R.KDGSHLDVLMNLLLKPGHEGLVEGFVADITER.K + Oxidation (M); Deamidated (NQ)
4600   1188.2825 3561.8257 3561.7695 15.8 1 78 1.1e-007 +1Score > 21 indicates identity U R.RLLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); 2 Deamidated (NQ)
4601   891.4670 3561.8389 3561.7695 19.5 1 49 8.1e-005 +1Score > 21 indicates identity U R.RLLVLDNEVSILESMGALLGQWGCEVVTATDR.E + Oxidation (M); 2 Deamidated (NQ)
4667   934.9985 3735.9649 3735.9319 8.83 1 55 2.1e-005 +1Score > 21 indicates identity U R.THQALEGAEDLLTDLLDISRLDQAAVKPDVAVYR.L + Deamidated (NQ)
4668   935.2471 3736.9593 3736.9159 11.6 1 33 0.0031 +1Score > 21 indicates identity U R.THQALEGAEDLLTDLLDISRLDQAAVKPDVAVYR.L + 2 Deamidated (NQ)
4670 +1 748.4008 3736.9676 3736.9159 13.8 1 11 0.57 +1Score > 21 indicates identity U R.THQALEGAEDLLTDLLDISRLDQAAVKPDVAVYR.L + 2 Deamidated (NQ)
4701   766.8223 3829.0751 3829.0189 14.7 1 31 0.0029 +1Score > 18 indicates identity U R.LDQAAVKPDVAVYRLDELFAPLVSEFSPVAEAAGLK.L + Deamidated (NQ)
4724   883.8679 4414.3031 4414.2400 14.3 1 48 7.1e-005 +1Score > 19 indicates identity U R.LLVLDNEVSILESMGALLGQWGCEVVTATDREGALLALQGR.A + Oxidation (M); 2 Deamidated (NQ)
4725 +1 1104.5850 4414.3109 4414.2400 16.1 1 64 1.4e-006 +1Score > 19 indicates identity U R.LLVLDNEVSILESMGALLGQWGCEVVTATDREGALLALQGR.A + Oxidation (M); 2 Deamidated (NQ)
4727   1104.8400 4415.3309 4415.2240 24.2 1 19 0.047 +1Score > 18 indicates identity U R.LLVLDNEVSILESMGALLGQWGCEVVTATDREGALLALQGR.A + Oxidation (M); 3 Deamidated (NQ)

4 subsets and intersections (4 subset proteins in total)

Score Mass Subset of
Q88NV0_PSEPK 72 0 1.1
description
Q88CR4_PSEPK 46 49354 1.1
Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_5116 PE=3 SV=1
A0A0H3C801_CAUVN 30 50659 1.1
Alpha-ketoglutaric semialdehyde dehydrogenase xylA OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=xylA PE=3 SV=1
Q88NZ2_PSEPK 25 158941 1.1
ATP-dependent DNA helicase lhr, putative OS=Pseudomonas putida (strain KT2440) GN=PP_1061 PE=4 SV=1

+2

Accession Score Description
1 Q88JG7_PSEPK 1226 Alcohol dehydrogenase, iron-containing OS=Pseudomonas putida (strain KT2440) GN=PP_2682 PE=4 SV=1

+3

Accession Score Description
1 TRYP_PIG 210 Trypsin OS=Sus scrofa PE=1 SV=1

+4

Accession Score Description
1 CH60_PSEPK 142 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1

+5

Accession Score Description
1 Q88M80_PSEPK 82 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_1694 PE=4 SV=1

+6

Accession Score Description
1 RS4_PSEPK 69 30S ribosomal protein S4 OS=Pseudomonas putida (strain KT2440) GN=rpsD PE=3 SV=1

+7

Accession Score Description
1 Q88I44_PSEPK 60 Inositol monophosphatase family protein OS=Pseudomonas putida (strain KT2440) GN=PP_3157 PE=4 SV=1

+8

Accession Score Description
1 Q88IY0_PSEPK 50 Oxidoreductase, FMN-binding OS=Pseudomonas putida (strain KT2440) GN=PP_2869 PE=4 SV=1

+9

Accession Score Description
Family member distances as a dendrogram 1 Q88JT1_PSEPK 46 Leucine-rich repeat domain protein OS=Pseudomonas putida (strain KT2440) GN=PP_2566 PE=4 SV=1
2 Q88BY3_PSEPK 38 Transposition protein, TnsC-related protein OS=Pseudomonas putida (strain KT2440) GN=PP_5404 PE=4 SV=1

+10

Accession Score Description
1 Q88L42_PSEPK 44 Response regulator NasT OS=Pseudomonas putida (strain KT2440) GN=nasT PE=4 SV=1
Page: 1 2 3 4 5 6  11 Next 

Not what you expected? Try the select summary.