MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 801–900 (out of 4336)

Page: Previous 1 …4 5 6 7 8 9 10 11 12 13 14 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4559 1000.5051 5996.9869 5996.9122 12.5 1 0 2.5 +1Score > 17 indicates identity GLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENTQAMADDLFAMIGSGK + 2 Oxidation (M); 3 Deamidated (NQ)
2693 1127.5828 1126.5755 1126.6234 -42.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GVEGLQSPIVK + Deamidated (NQ)
4418 1096.8113 4383.2161 4383.1728 9.87 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 YFMTIPEAAQLVVQAGAMGQGGDVFVLDMGEPVKIVELAEK + 2 Oxidation (M); Deamidated (NQ)
4000 915.1224 2742.3454 2742.3170 10.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 FYQMSPEERLASLLNEGQISADTK + Oxidation (M)
4035 709.8618 2835.4181 2835.3335 29.8 1 0 0.99 +1Score > 22 indicates identity
Score > 13 indicates homology		 SPTTRFFQHLFAAMCAFYMGNIPK + Deamidated (NQ)
2912 663.3272 1324.6398 1324.6915 -39.0 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 DLFELAFEITK
3536 1061.5404 2121.0662 2121.0558 4.91 1 0 0.96 +1Score > 23 indicates identity
Score > 13 indicates homology		 EKTLIVVDAMGQQSGTICR + Oxidation (M)
4502 1155.5919 5772.9231 5772.9496 -4.58 1 0 2.9 +1Score > 17 indicates identity VGALVVADNTFATPLNQNPLALGVDVVVHSATKFLSGHGDVLGGVVCGAEALMAQVR + Oxidation (M); 3 Deamidated (NQ)
4604 1018.0084 6102.0067 6101.9085 16.1 1 0 2 +1Score > 16 indicates identity FTQHHAQFPNVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAENITLQTMAMMIR + 3 Oxidation (M); 3 Deamidated (NQ)
2617 526.2688 1050.5230 1050.4838 37.4 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 AVDMMIQAR + Oxidation (M); Deamidated (NQ)
3015 362.9743 1447.8681 1447.8147 36.9 0 0 1.2 +1Score > 14 indicates identity VPIGENVNPAVIAR
3912 858.7086 2573.1040 2573.2141 -42.8 0 0 3 +1Score > 18 indicates identity ADTLLGAVQMNMLELHTWNATDK + 2 Deamidated (NQ)
2820 414.5916 1240.7530 1240.7252 22.4 1 0 2.5 +1Score > 17 indicates identity ERGVLVATLQR
3131 508.2791 1521.8155 1521.7398 49.7 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 NGWEGLVIYGCVR
3391 985.9459 1969.8772 1969.8298 24.1 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 HADEDMQRMYELFPR + 2 Oxidation (M); Deamidated (NQ)
3824 820.7584 2459.2534 2459.1849 27.8 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MNAELNNNPSAGNKAGGLTTILEK + 3 Deamidated (NQ)
3185 784.4205 1566.8264 1566.8188 4.88 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 HIMVGIIREDSPGK + Oxidation (M)
3199 396.4384 1581.7245 1581.7821 -36.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 FDVNTEGGKMISLR + Oxidation (M)
3716 770.4125 2308.2157 2308.1429 31.5 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 MPARCRPWSRPAAGVPGTDAR
3344 616.3145 1845.9217 1845.9849 -34.3 1 0 0.95 +1Score > 23 indicates identity
Score > 13 indicates homology		 GVLRGLHYQLAPHAQGK + 2 Deamidated (NQ)
3348 618.9880 1853.9422 1853.9523 -5.49 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LVTVFGASFNTDEVISR
3939 869.1032 2604.2878 2604.2232 24.8 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LSDWLDAAGTGAQFIDGLDSTGTPPV + Deamidated (NQ)
3321 593.2972 1776.8698 1776.9159 -25.9 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 VLDGSPGTPAAQPPRWK + Deamidated (NQ)
4280 927.7036 3706.7853 3706.8521 -18.0 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 YQPLPPVECLPSQINQVIMNLVLNAAQAMGPER + Oxidation (M); Deamidated (NQ)
4462 946.8959 4729.4431 4729.2586 39.0 1 0 3.6 +1Score > 18 indicates identity EALQSQEHALSEAIDQLQTQALLKMPDDSQQSGVLGLMDTLSR + 2 Oxidation (M); 3 Deamidated (NQ)
2771 601.2970 1200.5794 1200.6325 -44.2 0 0 0.97 +1Score > 22 indicates identity
Score > 13 indicates homology		 VQMFVPPLNR + Deamidated (NQ)
2902 441.5718 1321.6936 1321.7103 -12.6 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ATGELHVAGVGVGR
3567 534.0110 2132.0149 2132.0149 -0.013 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 FVEQQSAYCWAYQLIAR
4012 925.8013 2774.3821 2774.4279 -16.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 FYSEEEFSLHGLLQLQGPILELGR
2474 313.1783 936.5131 936.4817 33.5 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 KFNWQSK
3613 540.3029 2157.1825 2157.1582 11.3 1 0 4.8 +1Score > 20 indicates identity LLLEVAWEVFERAGLEQR
4137 817.4031 3265.5833 3265.6475 -19.7 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 NLLVLYTGGTIGMLETPEGLAPAGGFEARMR + 2 Oxidation (M)
3671 561.2745 2241.0689 2241.1113 -18.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 MPGILFVHGWGGSQQRDLAR + Oxidation (M); Deamidated (NQ)
2308 688.3892 687.3819 687.3803 2.39 0 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 IDAEIK
3718 578.2977 2309.1617 2309.2240 -27.0 1 0 0.98 +1Score > 23 indicates identity
Score > 13 indicates homology		 AAPALALVDELAHTNAPGSRHAK
3849 623.8014 2491.1765 2491.2021 -10.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 MNMNPDTPLQLLGGISAREFMR + Deamidated (NQ)
4105 781.4069 3121.5985 3121.5541 14.2 1 0 0.99 +1Score > 22 indicates identity
Score > 13 indicates homology		 RQVELPDGSHLELNGNTQLQVEFSAGQR
3437 685.0474 2052.1204 2052.1579 -18.3 0 0 0.98 +1Score > 21 indicates identity
Score > 13 indicates homology		 VNQLGIGAQGLGGLTTVLDVK
3975 891.7753 2672.3041 2672.1945 41.0 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 EGLAQGTFSLMADNLAMQNETQRK + Oxidation (M); 4 Deamidated (NQ)
4307 756.3447 3776.6871 3776.7549 -18.0 1 0 4.3 +1Score > 19 indicates identity TGPLVDQSGTYTRNAIMVNQPMFDDIVNNGLYSK + Oxidation (M); 3 Deamidated (NQ)
3920 860.4060 2578.1962 2578.1499 17.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 IFYQGQKDAGNGPNTYYGEISPR + 4 Deamidated (NQ)
3990 905.7774 2714.3104 2714.1952 42.4 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MSSENLVKMANQIAHYFDSEPDR + 2 Oxidation (M); Deamidated (NQ)
4078 995.1252 2982.3538 2982.4458 -30.9 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 WLDVGAQVKPGDTLATLDPTDQQNQLR + 4 Deamidated (NQ)
4317 951.7361 3802.9153 3802.7930 32.1 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 DIPELLRLVPGMMIGYGAGNQPTVNYHGSNVNDAR + 2 Oxidation (M); 3 Deamidated (NQ)
4366 1049.0409 4192.1345 4192.1765 -10.0 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 AGAAYVPIDTAYPAERLSYLMEDSGVALLVSQTAALAGLPK
2846 421.9307 1262.7703 1262.7095 48.1 1 0 1.2 +1Score > 13 indicates identity GLNPTKAIGHVR + Deamidated (NQ)
3318 885.9016 1769.7886 1769.8067 -10.2 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 HTQQQQLETQANALR + 5 Deamidated (NQ)
3335 907.4711 1812.9276 1812.9217 3.27 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ADAKTIAVPTAEVDANAR + Deamidated (NQ)
3353 625.6564 1873.9474 1873.8919 29.6 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 GTQGPSGQGATPQEFSGLR
3383 652.3425 1954.0057 1954.0636 -29.6 1 0 0.99 +1Score > 23 indicates identity
Score > 13 indicates homology		 ALQRVFELLGQNAALGPR + 2 Deamidated (NQ)
3941 654.2925 2613.1409 2613.2567 -44.3 0 0 4.4 +1Score > 19 indicates identity NDWVLGQISDCHALLNLGELAMK + Oxidation (M); Deamidated (NQ)
3804 608.5175 2430.0409 2430.1088 -27.9 1 0 2.6 +1Score > 17 indicates identity NAVVSLFTDSDFGNGYTGSRGHK + 2 Deamidated (NQ)
3842 828.4097 2482.2073 2482.2526 -18.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 AFKNVDVIQPGNGIMHQINLEK + Oxidation (M); 2 Deamidated (NQ)
3843 828.7626 2483.2660 2483.2366 11.8 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 AFKNVDVIQPGNGIMHQINLEK + Oxidation (M); 3 Deamidated (NQ)
3496 701.6976 2102.0710 2101.9925 37.3 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 DFMLAQTRQSDLDLFMR + Oxidation (M)
4109 783.9433 3131.7441 3131.6181 40.2 1 0 3.1 +1Score > 17 indicates identity NALKPQMVQLFADPALVTRQMLEDMLK + 2 Oxidation (M)
4588 759.2492 6065.9354 6065.8831 8.62 1 0 2.6 +1Score > 17 indicates identity LMQANGVQTQLQANASQPLPQGSQITVSQTESNRLAIMLQQASASQVATLTQLDTSK + 2 Oxidation (M); 11 Deamidated (NQ)
4630 901.4668 6303.2167 6303.2053 1.81 1 0 2.3 +1Score > 16 indicates identity LPLLALALGMSSPLVQAQMLQPGLWELTTSNMQVDGKPLPDMEFMLGQLKNLPPEQR + Oxidation (M); 3 Deamidated (NQ)
2546 496.2897 990.5648 990.5242 41.0 0 0 4.4 +1Score > 19 indicates identity SIPVSMMVK
2637 358.1938 1071.5596 1071.5171 39.6 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 CFKAYDIR
3841 826.4084 2476.2034 2476.1638 16.0 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MNAELNNNPSAGNKAGGLTTILEK + Oxidation (M); 4 Deamidated (NQ)
2857 634.3872 1266.7598 1266.7044 43.8 1 0 2.2 +1Score > 16 indicates identity QRGQQAQPLIK + Deamidated (NQ)
3317 885.4570 1768.8994 1768.8413 32.9 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 RHEAQLQQMQVELR + 4 Deamidated (NQ)
4083 753.8770 3011.4789 3011.4850 -2.01 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 DLDALARAEHADPFAVLGPHGDGAGGQVVR + Deamidated (NQ)
3728 776.4116 2326.2130 2326.1263 37.2 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 MPNPTRSTFFDITSEQGLLR + Oxidation (M); Deamidated (NQ)
4086 760.1697 3036.6497 3036.5628 28.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ELGLAGWVRNDGAGVDIEAQGSAAALVELR
1 300.0846 299.0773
2 300.1515 299.1442
3 300.1518 299.1445
4 300.1576 299.1503
5 300.1812 299.1739
6 301.0017 299.9944
7 301.0018 299.9945
8 301.0375 300.0302
9 301.0378 300.0305
10 301.0386 300.0313
11 301.0386 300.0313
12 301.0387 300.0314
13 301.0388 300.0315
14 301.0389 300.0316
15 301.0746 300.0673
16 301.0750 300.0677
17 301.0877 300.0804
18 301.0970 300.0897
19 301.1049 300.0976
20 301.1054 300.0981
21 301.1241 300.1168
22 301.1283 300.1210
23 301.1417 300.1344
24 301.1423 300.1350
25 301.1424 300.1351
26 301.1429 300.1356
27 301.1433 300.1360
28 301.1434 300.1361
29 301.1434 300.1361
30 301.1435 300.1362
31 301.1436 300.1363
32 301.1439 300.1366
33 301.1623 300.1550
34 301.1631 300.1558
Page: Previous 1 …4 5 6 7 8 9 10 11 12 13 14 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/