MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 4336)

Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2910 662.8356 1323.6566 1323.6783 -16.3 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 IVSETFTDRTR
2460 461.2872 920.5598 920.5443 16.9 0 2 0.98 +1Score > 14 indicates identity LAVEHKPK
3055 493.5501 1477.6285 1477.6547 -17.8 0 2 2.5 +1Score > 18 indicates identity AIEQFMQQYYR + 2 Deamidated (NQ)
3921 861.4803 2581.4191 2581.4326 -5.25 1 2 0.73 +1Score > 20 indicates identity
Score > 13 indicates homology		 SGLKLATELAALQGNISVDVQLALR + 2 Deamidated (NQ)
3130 381.4611 1521.8153 1521.7688 30.5 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 GVIAGEVYHLGNHR + Deamidated (NQ)
2328 357.2206 712.4266 712.4119 20.7 0 2 2.4 +1Score > 18 indicates identity NELLPK
3028 730.3808 1458.7470 1458.7249 15.2 0 2 0.73 +1Score > 23 indicates identity
Score > 13 indicates homology		 VALSMRPQDAQAR + Oxidation (M); Deamidated (NQ)
2931 679.8530 1357.6914 1357.6990 -5.54 1 2 0.9 +1Score > 23 indicates identity
Score > 14 indicates homology		 QVEWLQQRIR + 3 Deamidated (NQ)
3430 1018.0668 2034.1190 2034.0786 19.9 0 2 0.74 +1Score > 20 indicates identity
Score > 13 indicates homology		 LAELDKPVLVSEFQFGSR
4217 1121.5756 3361.7050 3361.7699 -19.3 1 2 0.87 +1Score > 21 indicates identity
Score > 14 indicates homology		 MSLLKNVIAVAACVLPMLAGAEEVGQVSTVFK + Oxidation (M); Deamidated (NQ)
2883 650.3355 1298.6564 1298.6830 -20.4 1 2 0.94 +1Score > 22 indicates identity
Score > 14 indicates homology		 ANLIIRGSTQPQ + 2 Deamidated (NQ)
3193 786.4285 1570.8424 1570.8202 14.1 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 GDVINGLDAAAKIEGK + Deamidated (NQ)
3864 839.4084 2515.2034 2515.2588 -22.0 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GLAGMQERVIALQGSLDITSQPGR + Oxidation (M); 3 Deamidated (NQ)
2519 324.5142 970.5208 970.5560 -36.2 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 KQIAGDLAR
3696 760.7667 2279.2783 2279.1831 41.8 0 2 3.1 +1Score > 19 indicates identity LINQGQTPMEIAQTLASLPPR + 2 Deamidated (NQ)
3499 1053.5602 2105.1058 2105.0438 29.5 0 2 0.97 +1Score > 22 indicates identity
Score > 14 indicates homology		 CVGGYAVVAMITGYGIVGFR + Oxidation (M)
3837 825.7642 2474.2708 2474.2322 15.6 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SLMSQPSDSALAELTLALAANAER + Oxidation (M)
2744 592.2939 1182.5732 1182.5551 15.4 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 MSTGTTTLTDR
3024 727.3618 1452.7090 1452.7725 -43.6 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AIYRAEYLIEGR
3041 736.3528 1470.6910 1470.7388 -32.5 0 2 0.99 +1Score > 22 indicates identity
Score > 14 indicates homology		 DLLAPEDMLALDR
4075 993.4984 2977.4734 2977.5509 -26.0 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DRLATDASLQLDYTPSPALLPNLSHLR + Deamidated (NQ)
4408 1091.5687 4362.2457 4362.1068 31.8 1 2 3.3 +1Score > 19 indicates identity QPEQDAQMLTAIIEQLEYQGLLKQANAQADGQMLAMLTR + 4 Deamidated (NQ)
3723 774.4314 2320.2724 2320.2963 -10.3 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EVSVLGNVSLSLFLAIALMSLK + Oxidation (M); Deamidated (NQ)
3905 856.1461 2565.4165 2565.4013 5.92 1 2 2.9 +1Score > 19 indicates identity IEALELQNLLEVAEATAIAAEARK
4275 613.6660 3675.9523 3675.8000 41.4 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MSVECFVTGGSGFVGQHLLAGLTAQGHKTWVLMR + 2 Deamidated (NQ)
2641 538.2684 1074.5222 1074.5247 -2.26 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 VGYHFPQAR + Deamidated (NQ)
3187 784.4415 1566.8684 1566.8518 10.6 1 2 0.89 +1Score > 21 indicates identity
Score > 14 indicates homology		 WRVEPQAQLIAQK + Deamidated (NQ)
3775 795.4158 2383.2256 2383.2132 5.21 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AQTLNALAALSAGADHPAVFTSTR + Deamidated (NQ)
3294 864.9747 1727.9348 1727.9604 -14.8 1 2 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology		 LQPVMTLQSRVISVR + 2 Deamidated (NQ)
3493 701.0449 2100.1129 2100.0586 25.8 1 2 0.72 +1Score > 22 indicates identity
Score > 13 indicates homology		 EVLSEGQEVIVQVEKEER + Deamidated (NQ)
3767 595.8063 2379.1961 2379.2897 -39.3 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GNVLDPLDIVDGITLDALLEKR + Deamidated (NQ)
3248 544.2684 1629.7834 1629.7859 -1.57 0 2 0.99 +1Score > 22 indicates identity
Score > 14 indicates homology		 SHGSAGVQGFQSAIQR + Deamidated (NQ)
3374 644.6663 1930.9771 1930.9644 6.54 1 2 0.87 +1Score > 23 indicates identity
Score > 14 indicates homology		 LNTGMLHPMDIYQIRK + 2 Deamidated (NQ)
3761 792.7465 2375.2177 2375.3060 -37.2 1 2 0.92 +1Score > 22 indicates identity
Score > 14 indicates homology		 SGVVGVLATTGTLQSAKFAALLDR + Deamidated (NQ)
2371 785.4145 784.4072 784.3828 31.2 0 2 3.1 +1Score > 19 indicates identity QPEQQR
3279 845.3795 1688.7444 1688.7060 22.8 0 2 0.91 +1Score > 20 indicates identity
Score > 14 indicates homology		 HSQDSMQIANQAGER + Oxidation (M); 2 Deamidated (NQ)
3760 792.0811 2373.2215 2373.1448 32.3 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 VVDNTLQTAQQAYEASNPAPVR + 2 Deamidated (NQ)
3414 1004.9492 2007.8838 2007.9605 -38.2 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NGKVVMGGDGQVSLGNTVMK + Oxidation (M); 2 Deamidated (NQ)
3709 1152.6255 2303.2364 2303.2130 10.2 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 RTLIAFCLLALCLPATADQR + Deamidated (NQ)
3812 611.0699 2440.2505 2440.1661 34.6 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DPNLMGACAGGLTMAALQGHLQAK + Oxidation (M)
3384 978.0472 1954.0798 1954.0020 39.8 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VLASPQQIRQSAQSFHR + 2 Deamidated (NQ)
4458 1181.6249 4722.4705 4722.4656 1.03 1 2 2.3 +1Score > 18 indicates identity EMDFSEIIPALPALWEGMVMTLKLMVMGVIGGIVLGTILALMR + 4 Oxidation (M)
2861 635.8136 1269.6126 1269.6353 -17.9 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DKAYAALSQFR + Deamidated (NQ)
3628 1086.0295 2170.0444 2170.1092 -29.8 1 2 0.83 +1Score > 23 indicates identity
Score > 13 indicates homology		 MALDPLAFVEPLLNRDQAR + 2 Deamidated (NQ)
2995 720.8506 1439.6866 1439.7005 -9.59 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LDNLVNAQGGDAPR + Deamidated (NQ)
4043 716.1435 2860.5449 2860.4463 34.5 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MEAVSMTTLNFELAVQLAVATLHQAR + Oxidation (M); Deamidated (NQ)
3149 512.5571 1534.6495 1534.6171 21.1 0 2 2 +1Score > 17 indicates identity QQLDHADNNSYAR + 4 Deamidated (NQ)
3642 729.4028 2185.1866 2185.1525 15.6 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LLSSAGINSLCAVDLANLQAR
4417 1095.5706 4378.2533 4378.1018 34.6 1 2 0.81 +1Score > 20 indicates identity
Score > 13 indicates homology		 QPEQDAQMLTAIIEQLEYQGLLKQANAQADGQMLAMLTR + Oxidation (M); 4 Deamidated (NQ)
3162 773.3985 1544.7824 1544.7682 9.22 1 1 0.99 +1Score > 23 indicates identity
Score > 14 indicates homology		 KTLDTQTGQPVEAR + 2 Deamidated (NQ)
3242 405.4501 1617.7713 1617.7668 2.78 0 1 0.89 +1Score > 23 indicates identity
Score > 13 indicates homology		 MGQALLDNLAGAGETR + 2 Deamidated (NQ)
3685 568.7914 2271.1365 2271.2270 -39.8 1 1 0.79 +1Score > 23 indicates identity
Score > 13 indicates homology		 VAAVVANPQPMLVRLQGHAQR + Oxidation (M); Deamidated (NQ)
4523 1171.3809 5851.8681 5852.1453 -47.4 1 1 2.3 +1Score > 18 indicates identity DLMDAAQLLGASTWQAALLVVLPNLRQGLMVAVLLSFSFLFGEFVFANLLVGTR + Oxidation (M); Deamidated (NQ)
2848 422.2471 1263.7195 1263.7411 -17.1 1 1 3.2 +1Score > 19 indicates identity RALIVLAHSER
2682 372.8585 1115.5537 1115.6047 -45.7 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 QAQALVRSSR + Deamidated (NQ)
2895 329.9054 1315.5925 1315.5516 31.1 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology		 AWHWNATDCR
3035 488.2244 1461.6514 1461.7034 -35.6 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VIAYDMLGHGQSR + Oxidation (M)
3764 595.5583 2378.2041 2378.1350 29.1 0 1 0.96 +1Score > 22 indicates identity
Score > 14 indicates homology		 SGSEVILSVENQGPGVPAEHQSR + 2 Deamidated (NQ)
3782 799.0659 2394.1759 2394.2682 -38.6 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IINAITESLNLPPEALELTWR + 2 Deamidated (NQ)
2826 312.1749 1244.6705 1244.6183 41.9 1 1 0.99 +1Score > 22 indicates identity
Score > 14 indicates homology		 GGVGVEIERGCL
3913 858.7357 2573.1853 2573.2834 -38.1 1 1 0.83 +1Score > 21 indicates identity
Score > 13 indicates homology		 TERQALVGDGQGPGYAALTSQIGQR + Deamidated (NQ)
3421 673.0368 2016.0886 2015.9946 46.6 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 DTGGQDIAAKAAELLLCDR
3687 758.7311 2273.1715 2273.1726 -0.48 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 QGFELPLMIGGATTSKAHTAVK + Oxidation (M); Deamidated (NQ)
3872 841.7892 2522.3458 2522.3380 3.08 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GLADSGLPNYARLAAQLPDPALAVK + 2 Deamidated (NQ)
3140 383.4495 1529.7689 1529.7806 -7.68 1 1 0.81 +1Score > 23 indicates identity
Score > 13 indicates homology		 MRIDSLMLSHGVR + Oxidation (M)
3690 1138.0955 2274.1764 2274.2695 -40.9 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AQARLLDALAAIPQALGISPQR + 2 Deamidated (NQ)
3413 502.7683 2007.0441 2007.0160 14.0 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 SEALQLKPLDPNNPDVQK + 2 Deamidated (NQ)
3305 880.4536 1758.8926 1758.9087 -9.11 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 ASAAIPSLFTPVMQGNR
3422 673.7066 2018.0980 2018.1273 -14.5 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SGDPAVIRLNPLDNVVIAR
2725 386.5581 1156.6525 1156.6313 18.3 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 QRTLSVNPSR
4257 874.6947 3494.7497 3494.8049 -15.8 0 1 0.93 +1Score > 21 indicates identity
Score > 13 indicates homology		 MPEATQLLTFALICLGMVLTPGPNMIYLISR + 2 Oxidation (M)
3973 887.4120 2659.2142 2659.3170 -38.7 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 ESSILFVDGHDFKGSGFYVDSILK
4114 786.4076 3141.6013 3141.6433 -13.4 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 AAFVGGAFGSGLRPQYQLPLAVMAALHLQR + 3 Deamidated (NQ)
4412 874.8530 4369.2286 4369.1069 27.9 1 1 0.79 +1Score > 20 indicates identity
Score > 13 indicates homology		 MKLSAWLLLSGLLLCGCDQPAPQSYAGLGQQAGEFSQVTR + Oxidation (M); 3 Deamidated (NQ)
2523 487.2486 972.4826 972.4777 5.07 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 HGFQGASIR + Deamidated (NQ)
3790 801.4222 2401.2448 2401.2576 -5.35 0 1 0.93 +1Score > 22 indicates identity
Score > 13 indicates homology		 ELIDFAGGIAVNALGHCHPALVK
3154 770.9155 1539.8164 1539.7947 14.1 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 TWTLVPDGPGRWR
4054 970.8085 2909.4037 2909.5174 -39.1 1 1 0.89 +1Score > 22 indicates identity
Score > 13 indicates homology		 GDLTNFLPLDPLFSNLLPAPDNLQKR + 2 Deamidated (NQ)
3748 590.2958 2357.1541 2357.2301 -32.2 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GQYPQIPVVMVSAQEEAAVVVK + Oxidation (M)
3719 771.4493 2311.3261 2311.2212 45.4 0 1 1.9 +1Score > 17 indicates identity WSQPLEILAQAFPSLEVEVR
3277 844.8875 1687.7604 1687.7900 -17.5 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GGDLGSAINQLEVEQR + 3 Deamidated (NQ)
3313 881.9457 1761.8768 1761.9624 -48.6 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 HIISLLLENEPGALSR + Deamidated (NQ)
3602 717.6971 2150.0695 2150.0790 -4.42 0 1 0.93 +1Score > 23 indicates identity
Score > 13 indicates homology		 QDCAIVEQALADLDALHLR
3217 801.9080 1601.8014 1601.8083 -4.28 0 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 AMLASVTPQLLDGDR + Oxidation (M)
3508 1055.5433 2109.0720 2109.1371 -30.8 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NALYQRFGVFAGVVVEALR + Deamidated (NQ)
4104 779.8845 3115.5089 3115.4808 9.01 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LDQAMDSGQYTFVINVPVNFQSDLLAGR + Oxidation (M); 2 Deamidated (NQ)
4189 1108.9158 3323.7256 3323.7183 2.19 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LDSLMAIGPARANPAFANDSLNALTAGKPEAVK + Deamidated (NQ)
2387 804.4222 803.4149 803.3773 46.8 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 IEASDNR
3656 735.7177 2204.1313 2204.0711 27.3 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 CGLTPQYKALENLYQIYK + 3 Deamidated (NQ)
2718 574.2353 1146.4560 1146.4789 -19.9 0 1 0.78 +1Score > 13 indicates identity QQNGNLANQR + 5 Deamidated (NQ)
3403 996.5329 1991.0512 1991.0152 18.1 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DGHWALAYTGTIAFIINK + Deamidated (NQ)
3713 770.0505 2307.1297 2307.2110 -35.2 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 AILDLQAASRFIETKPENYK + Deamidated (NQ)
4198 834.4109 3333.6145 3333.7027 -26.4 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 ITGLNGQGESSELALLLRAGGLAAPMYFAEER
4409 1091.5750 4362.2709 4362.1068 37.6 1 1 3.6 +1Score > 19 indicates identity QPEQDAQMLTAIIEQLEYQGLLKQANAQADGQMLAMLTR + 4 Deamidated (NQ)
4436 915.6666 4573.2966 4573.4863 -41.5 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LLLMLSAAVLLVGCTSEEEAPEVIRPVLSVKVEPQVQSQLGR + Oxidation (M)
3697 571.5641 2282.2273 2282.1866 17.8 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GRLDVAGTLQAPQGTLTLQGQR + 3 Deamidated (NQ)
3903 854.4041 2560.1905 2560.1441 18.1 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LAFDNDPQAFCAHWAQAQAQLR + 3 Deamidated (NQ)
4573 1008.1696 6042.9739 6043.1299 -25.8 1 1 2.4 +1Score > 17 indicates identity PNHLHSPHLSTRFQALDQFLIEHQQLWKPRPFTSLQLAWETAHPELAAHLR + Deamidated (NQ)
3484 700.7123 2099.1151 2099.1085 3.14 1 1 0.85 +1Score > 21 indicates identity
Score > 13 indicates homology		 AVLNPQSLTKMPTVGAWLR + Oxidation (M); 2 Deamidated (NQ)
3998 911.4810 2731.4212 2731.3408 29.4 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 AMPEEQGLELMENLLVGGIERTLR + 2 Oxidation (M); 2 Deamidated (NQ)
Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/