MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4336)


Page: Previous 1 2 3 4 5 6 7 8 9 10  44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2700 1135.6180 1134.6107 1134.6550 -39.0 0 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
VLGAFVNLFR
3147 512.2785 1533.8137 1533.8151 -0.93 1 4 1 +1Score > 23 indicates identity
Score > 17 indicates homology
RQFVEVASQVLTR + 2 Deamidated (NQ)
4260 704.9775 3519.8511 3519.7304 34.3 1 4 0.42 +1Score > 20 indicates identity
Score > 13 indicates homology
NACTVDAVITVVDSPAVAAGTFAAYPDQVDAQRK
2634 535.7523 1069.4900 1069.5080 -16.8 0 4 1.7 +1Score > 19 indicates identity FIDDQYIR + Deamidated (NQ)
2211 605.3131 604.3058 604.3068 -1.58 0 4 1 +1Score > 22 indicates identity
Score > 17 indicates homology
LSEQK + Deamidated (NQ)
2424 872.4745 871.4672 871.4875 -23.3 0 4 0.95 +1Score > 23 indicates identity
Score > 16 indicates homology
ASQLQGLR
2576 506.7820 1011.5494 1011.5713 -21.6 1 4 0.81 +1Score > 20 indicates identity
Score > 16 indicates homology
LNPPSRLSK + Deamidated (NQ)
3655 1103.0690 2204.1234 2204.0709 23.8 0 4 0.47 +1Score > 23 indicates identity
Score > 13 indicates homology
YLLTNTGNANAGTGAPGLAAAER + 2 Deamidated (NQ)
2839 624.8960 1247.7774 1247.7462 25.0 1 4 0.39 +1Score > 13 indicates identity IHLDLVQRVR
3085 498.8814 1493.6224 1493.6932 -47.4 1 4 0.98 +1Score > 17 indicates identity ADGEAFMARQQLR + 2 Deamidated (NQ)
3732 781.3859 2341.1359 2341.1480 -5.18 1 4 1 +1Score > 23 indicates identity
Score > 17 indicates homology
MVFNGGALIGCDLGTMNVAKIK + 2 Oxidation (M); Deamidated (NQ)
2372 393.2297 784.4448 784.4807 -45.7 0 4 0.99 +1Score > 20 indicates identity
Score > 17 indicates homology
LLSPSLR
2802 613.3884 1224.7622 1224.7190 35.3 0 4 0.39 +1Score > 13 indicates identity IGDLLLQAVAGR
3215 801.4053 1600.7960 1600.7290 41.9 1 4 0.68 +1Score > 23 indicates identity
Score > 15 indicates homology
SNKEIADSMYLSNK + 2 Deamidated (NQ)
3240 809.4598 1616.9050 1616.9576 -32.5 0 4 0.83 +1Score > 20 indicates identity
Score > 16 indicates homology
LGVVVTFMAVLELVK
3314 588.2998 1761.8776 1761.8203 32.5 0 4 1 +1Score > 23 indicates identity
Score > 17 indicates homology
GENDGALETLLAMQER + Oxidation (M)
2377 786.4426 785.4353 785.4395 -5.35 0 4 0.5 +1Score > 20 indicates identity
Score > 14 indicates homology
LLGEQAR
2258 641.4380 640.4307 640.4020 44.8 0 4 0.39 +1Score > 13 indicates identity LRPQK
3030 488.2181 1461.6325 1461.6955 -43.1 1 4 1.7 +1Score > 19 indicates identity AKIDMASPNMNLR + 2 Deamidated (NQ)
3785 599.7991 2395.1673 2395.1754 -3.38 0 4 0.42 +1Score > 23 indicates identity
Score > 13 indicates homology
QPDLQAALDNQALVQQLLQQR + 6 Deamidated (NQ)
2380 790.3982 789.3909 789.4054 -18.4 0 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
LLQQMR + 2 Deamidated (NQ)
2673 367.5269 1099.5589 1099.5338 22.8 0 4 1 +1Score > 23 indicates identity
Score > 16 indicates homology
YLEQWYAK
3860 837.0641 2508.1705 2508.1227 19.1 1 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
GDYQESWQPQAMSPKALAESQR + 2 Deamidated (NQ)
3851 832.0829 2493.2269 2493.1958 12.5 1 4 0.78 +1Score > 23 indicates identity
Score > 15 indicates homology
HLKDPAMFELDHDLAQDIVDR + Oxidation (M)
2676 1112.5328 1111.5255 1111.5695 -39.6 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MPAALPQLDR + Deamidated (NQ)
3245 812.9181 1623.8216 1623.9018 -49.3 0 4 0.67 +1Score > 23 indicates identity
Score > 15 indicates homology
IAIVNDMPLAVEALR
4100 771.9288 3083.6861 3083.5419 46.7 1 4 1.8 +1Score > 19 indicates identity MSLRICILETDVLRPELTAQYQGYGR + 2 Deamidated (NQ)
2929 678.3140 1354.6134 1354.5751 28.3 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MQAEGFPAEPVY + Oxidation (M); Deamidated (NQ)
3627 434.9750 2169.8386 2169.9030 -29.7 0 4 0.42 +1Score > 13 indicates identity HAWDQVSQGMQMVMHDPR + Oxidation (M); 2 Deamidated (NQ)
2347 376.7189 751.4232 751.4089 19.1 0 4 1.2 +1Score > 17 indicates identity ALQQHR
4434 914.4614 4567.2706 4567.1141 34.3 0 4 1.8 +1Score > 19 indicates identity QEVDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQAR + 2 Oxidation (M); 3 Deamidated (NQ)
3368 639.0129 1914.0169 1914.0211 -2.19 1 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
FVQDLKVLPEAEQVGSR
3581 535.5135 2138.0249 2137.9296 44.6 1 4 0.66 +1Score > 22 indicates identity
Score > 14 indicates homology
DTGEYLYTMTDMQQRLR + Oxidation (M); 2 Deamidated (NQ)
2539 492.2646 982.5146 982.4693 46.2 1 4 0.6 +1Score > 21 indicates identity
Score > 14 indicates homology
HSRADNQR
3038 488.2751 1461.8035 1461.7576 31.4 1 4 0.93 +1Score > 21 indicates identity
Score > 16 indicates homology
LRQAFAAQDTLAR + 2 Deamidated (NQ)
3056 493.5502 1477.6288 1477.6547 -17.6 0 4 1.6 +1Score > 18 indicates identity AIEQFMQQYYR + 2 Deamidated (NQ)
4599 1015.9967 6089.9365 6089.7551 29.8 1 4 0.85 +1Score > 16 indicates identity YAACMTAALADAELTSAAVDHVNVHGTSTQANDRCEALGLAQVFGETLEQMTFTANK + Oxidation (M); 4 Deamidated (NQ)
2306 683.3264 682.3191 682.3142 7.20 0 4 1.5 +1Score > 18 indicates identity LMMTR + 2 Oxidation (M)
2774 401.9264 1202.7574 1202.7056 43.0 1 4 0.43 +1Score > 13 indicates identity SGKLMAINLLK + Oxidation (M)
3681 565.2679 2257.0425 2257.1550 -49.8 1 4 0.66 +1Score > 21 indicates identity
Score > 14 indicates homology
TIADQQARTLGDVLLNDASVR + 2 Deamidated (NQ)
2855 634.3168 1266.6190 1266.5849 27.0 1 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
MPGDLFMERR + Oxidation (M)
2416 428.2705 854.5264 854.5338 -8.58 0 4 1.2 +1Score > 17 indicates identity LAAIVGGVR
3346 462.4888 1845.9261 1845.9156 5.70 0 4 1 +1Score > 23 indicates identity
Score > 16 indicates homology
VLIDNLDVSHQPMHGR + Oxidation (M)
3080 745.9152 1489.8158 1489.8140 1.22 0 4 0.46 +1Score > 21 indicates identity
Score > 13 indicates homology
FEVSDAASLLAVLR
3856 625.5662 2498.2357 2498.1924 17.3 1 4 1 +1Score > 23 indicates identity
Score > 16 indicates homology
RQEAFDALEHAQQVNQQLIVR + 6 Deamidated (NQ)
2482 470.7394 939.4642 939.4662 -2.03 1 4 0.95 +1Score > 20 indicates identity
Score > 16 indicates homology
FSSQTKDK
2953 703.8525 1405.6904 1405.6403 35.7 0 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
QALMAEHMALMK + 2 Oxidation (M); Deamidated (NQ)
3036 366.4204 1461.6525 1461.7245 -49.3 1 4 0.52 +1Score > 20 indicates identity
Score > 13 indicates homology
AQQIATSLNACKR + 2 Deamidated (NQ)
2654 543.2763 1084.5380 1084.5513 -12.2 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
SDAVLNPGGVR + Deamidated (NQ)
3786 480.0410 2395.1686 2395.1512 7.29 1 4 0.59 +1Score > 23 indicates identity
Score > 14 indicates homology
VKEAMGSQVCSVYLLDPETNR
4060 729.6603 2914.6121 2914.5804 10.9 1 4 1.8 +1Score > 19 indicates identity QILIIGAGFAGLWSALSAIRQLDLNGSK + 3 Deamidated (NQ)
3426 675.0531 2022.1375 2022.0680 34.4 1 4 1.9 +1Score > 19 indicates identity QSAPGRLAGAAADMLPLVQR + Deamidated (NQ)
2791 405.9103 1214.7091 1214.6619 38.9 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
VRLQIAEETR + Deamidated (NQ)
2772 601.8448 1201.6750 1201.6489 21.8 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
ASGLIRPMVDK + Oxidation (M)
3924 517.4348 2582.1376 2582.2208 -32.2 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
GAAVNQDGASNGLTAPNGPSQERVIR + 4 Deamidated (NQ)
3063 494.5540 1480.6402 1480.7126 -48.9 1 4 0.52 +1Score > 20 indicates identity
Score > 13 indicates homology
MVSLMTQDARAAR + 2 Oxidation (M)
2942 460.5799 1378.7179 1378.7065 8.23 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
QNHERGIAIGQR + Deamidated (NQ)
3202 529.2693 1584.7861 1584.8372 -32.3 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
HEQREYALLALSR
2296 676.4043 675.3970 675.3738 34.4 0 3 2 +1Score > 19 indicates identity LVAAMR + Oxidation (M)
4200 1112.5449 3334.6129 3334.6061 2.03 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
IQADNAHLDDKQGVATYTGDVIITQGSMMIK + 2 Deamidated (NQ)
2834 416.9324 1247.7754 1247.7462 23.4 1 3 0.45 +1Score > 13 indicates identity IHLDLVQRVR
3062 740.8698 1479.7250 1479.7933 -46.1 1 3 0.6 +1Score > 23 indicates identity
Score > 14 indicates homology
GQHEKDIVLQIAK + 2 Deamidated (NQ)
3396 990.4972 1978.9798 1978.9881 -4.16 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
LSETMSVDLQLKNLTNR + Oxidation (M); 2 Deamidated (NQ)
3534 530.7615 2119.0169 2119.0069 4.73 1 3 0.67 +1Score > 23 indicates identity
Score > 14 indicates homology
DLSAISNNIWGNDAQKITR + 4 Deamidated (NQ)
4353 669.1686 4008.9679 4008.8496 29.5 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
SPFMDMQLVAKYAEEGTDPAEPAVQISQGVQQNLGVR + 6 Deamidated (NQ)
4271 903.9550 3611.7909 3611.8413 -13.9 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
LQPDSFIFIGQGAFVPPGEGPVPRQNAVAQQAFK + 2 Deamidated (NQ)
2423 871.4893 870.4820 870.4559 30.0 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
QRPLTEGA
3733 781.3991 2341.1755 2341.2317 -24.0 0 3 0.58 +1Score > 23 indicates identity
Score > 14 indicates homology
INTFLQAWLQAHNLSLQTLK + 3 Deamidated (NQ)
4276 736.1989 3675.9581 3675.7760 49.6 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
TFSPNLDQMTPEQLRALAAQALQLQSQVEAMSR + 4 Deamidated (NQ)
2557 331.8302 992.4688 992.4788 -10.1 1 3 0.54 +1Score > 23 indicates identity
Score > 13 indicates homology
QQYRQNR + Deamidated (NQ)
3121 758.9303 1515.8460 1515.7893 37.5 1 3 0.55 +1Score > 21 indicates identity
Score > 13 indicates homology
TEQDRGVITLLDR + Deamidated (NQ)
3012 483.5617 1447.6633 1447.6402 16.0 0 3 0.63 +1Score > 21 indicates identity
Score > 14 indicates homology
SLDQQPAWQAMR + Oxidation (M); 2 Deamidated (NQ)
4439 1160.3710 4637.4549 4637.2392 46.5 1 3 1.9 +1Score > 19 indicates identity MANHKPEIVITYCTQCQWLLRAAWLAQELLSTFADDLGR + Oxidation (M); 3 Deamidated (NQ)
2415 426.7561 851.4976 851.4725 29.5 1 3 1.2 +1Score > 17 indicates identity LAAQHRR + Deamidated (NQ)
3569 712.3531 2134.0375 2134.0398 -1.10 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
GVVMLERDVEQATLAEMAR + Oxidation (M); Deamidated (NQ)
3780 798.3725 2392.0957 2392.1733 -32.4 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
AFGDNLVLYPNPVAMAQDLTSR + Deamidated (NQ)
2242 626.4276 625.4203 625.4024 28.7 0 3 0.75 +1Score > 15 indicates identity VVRPR
4032 943.4928 2827.4566 2827.4095 16.6 1 3 0.53 +1Score > 22 indicates identity
Score > 13 indicates homology
RLTQANLHSDPAMIDEVAQLMITVK + 2 Oxidation (M); 2 Deamidated (NQ)
3057 493.5554 1477.6444 1477.6904 -31.2 1 3 0.91 +1Score > 20 indicates identity
Score > 15 indicates homology
AKIDMASPNMNLR + Oxidation (M); 2 Deamidated (NQ)
3527 1059.5294 2117.0442 2117.0575 -6.28 1 3 0.78 +1Score > 23 indicates identity
Score > 15 indicates homology
FGDGACDLAPLSGLVKNQVR + Deamidated (NQ)
3770 794.0821 2379.2245 2379.2659 -17.4 1 3 0.68 +1Score > 22 indicates identity
Score > 14 indicates homology
AETEALLGGLHQQPLLRSQYR
3827 821.7520 2462.2342 2462.2410 -2.77 1 3 0.83 +1Score > 22 indicates identity
Score > 15 indicates homology
MTFGQGALPQALGQELLRMTGAR + Oxidation (M); Deamidated (NQ)
3598 537.2657 2145.0337 2144.9870 21.8 1 3 0.56 +1Score > 23 indicates identity
Score > 13 indicates homology
MKAEQMAADYQQLFGGLAR + Oxidation (M); 2 Deamidated (NQ)
3779 1197.0533 2392.0920 2392.1733 -34.0 0 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
AFGDNLVLYPNPVAMAQDLTSR + Deamidated (NQ)
3298 581.6438 1741.9096 1741.9032 3.64 1 3 0.82 +1Score > 22 indicates identity
Score > 15 indicates homology
QAEARMPQAVLTQGLK + 2 Deamidated (NQ)
2769 600.8654 1199.7162 1199.6808 29.5 1 3 2.2 +1Score > 19 indicates identity LIQACGRLLR + Deamidated (NQ)
3379 647.3215 1938.9427 1938.9687 -13.4 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
NVVFQAQLGTVYDKAER + 2 Deamidated (NQ)
4292 630.2847 3775.6645 3775.7709 -28.2 1 3 1.7 +1Score > 18 indicates identity TGPLVDQSGTYTRNAIMVNQPMFDDIVNNGLYSK + Oxidation (M); 2 Deamidated (NQ)
3749 786.7266 2357.1580 2357.2301 -30.6 0 3 0.62 +1Score > 23 indicates identity
Score > 14 indicates homology
GQYPQIPVVMVSAQEEAAVVVK + Oxidation (M)
3086 499.6040 1495.7902 1495.7936 -2.27 1 3 0.81 +1Score > 22 indicates identity
Score > 15 indicates homology
RSVPSVYAWLYR
3192 786.4006 1570.7866 1570.8467 -38.3 1 3 0.95 +1Score > 22 indicates identity
Score > 15 indicates homology
QEPIGTRIFGPVTR + Deamidated (NQ)
3857 626.3088 2501.2061 2501.2298 -9.49 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
QYIANLSWQATHDALTGLANRR + 3 Deamidated (NQ)
4013 695.8580 2779.4029 2779.3422 21.8 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
GLLAGFGPGITAEMSLGCWQTADVRR + Oxidation (M); Deamidated (NQ)
3350 928.9794 1855.9442 1856.0003 -30.2 1 3 0.84 +1Score > 23 indicates identity
Score > 15 indicates homology
AKIEQQLGETASQAILR + Deamidated (NQ)
2920 667.8513 1333.6880 1333.7466 -43.9 1 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology
TNIPLHRDLVR + Deamidated (NQ)
4087 1013.2246 3036.6520 3036.5628 29.4 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
ELGLAGWVRNDGAGVDIEAQGSAAALVELR
2764 398.5513 1192.6321 1192.6175 12.2 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
NGFCLWLKR
2963 711.8411 1421.6676 1421.6575 7.13 0 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
IDQAQSAFEAWR + Deamidated (NQ)
2238 312.1655 622.3164 622.2996 27.1 0 3 0.77 +1Score > 21 indicates identity
Score > 14 indicates homology
MNLTK + Oxidation (M); Deamidated (NQ)
2479 470.7147 939.4148 939.4232 -8.93 0 3 1.8 +1Score > 18 indicates identity MSNHHVAK + Oxidation (M); Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 10  44 Next 

Not what you expected? Try the select summary.