MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 4336)


Page: Previous 1 2 3 4 5 6 7 8 9  44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2997 720.8580 1439.7014 1439.7191 -12.2 1 6 1 +1Score > 22 indicates identity
Score > 19 indicates homology
NSRVMLLASYNR + Oxidation (M); Deamidated (NQ)
2709 572.2969 1142.5792 1142.6230 -38.3 1 6 0.57 +1Score > 22 indicates identity
Score > 16 indicates homology
RMTIAVPAER
2885 650.8210 1299.6274 1299.6717 -34.1 1 6 0.56 +1Score > 22 indicates identity
Score > 16 indicates homology
IADGKLNRPCR + Deamidated (NQ)
2779 604.3815 1206.7484 1206.7197 23.9 1 6 0.26 +1Score > 13 indicates identity LVHTLARQLR + Deamidated (NQ)
2932 680.3486 1358.6826 1358.7293 -34.3 0 6 0.82 +1Score > 23 indicates identity
Score > 17 indicates homology
ITTLIENGELEK
2583 512.8005 1023.5864 1023.5964 -9.73 1 6 0.82 +1Score > 17 indicates identity LAISNPKALP + Deamidated (NQ)
2926 450.9045 1349.6917 1349.7527 -45.2 1 6 0.37 +1Score > 22 indicates identity
Score > 14 indicates homology
SRNALGNLGHALK
2988 478.2508 1431.7306 1431.6895 28.7 1 6 0.75 +1Score > 23 indicates identity
Score > 17 indicates homology
TYPPQAWERQR + Deamidated (NQ)
2724 579.3032 1156.5918 1156.6353 -37.6 1 6 0.55 +1Score > 23 indicates identity
Score > 16 indicates homology
FVRLHAETGK
3631 543.7562 2170.9957 2171.0494 -24.8 1 6 0.37 +1Score > 22 indicates identity
Score > 14 indicates homology
AETGINYENRSLGTTQLFR + 2 Deamidated (NQ)
4466 1185.8623 4739.4201 4739.3615 12.4 0 6 1.1 +1Score > 18 indicates identity LQGQVFDLIFVNAGVMGPLPQDLEAVHNSDIGDLFMTNAVAPIR + Oxidation (M); 2 Deamidated (NQ)
2623 531.2810 1060.5474 1060.5149 30.7 0 6 1 +1Score > 23 indicates identity
Score > 18 indicates homology
INGSGSLQQR + 2 Deamidated (NQ)
2425 436.7413 871.4680 871.4664 1.87 1 6 0.8 +1Score > 23 indicates identity
Score > 17 indicates homology
FNHAKVR + Deamidated (NQ)
2537 491.2784 980.5422 980.5654 -23.7 1 6 1.1 +1Score > 19 indicates identity ELEKLPPR
2476 313.5043 937.4911 937.4617 31.3 1 6 0.54 +1Score > 20 indicates identity
Score > 15 indicates homology
RSADQYAK
3136 509.9312 1526.7718 1526.8192 -31.0 0 6 0.43 +1Score > 23 indicates identity
Score > 14 indicates homology
QAGVAIEQVSVPSIK + 2 Deamidated (NQ)
2420 433.2560 864.4974 864.5042 -7.81 1 6 0.71 +1Score > 17 indicates identity LGRNHLR
2786 605.8066 1209.5986 1209.6063 -6.33 1 6 0.33 +1Score > 21 indicates identity
Score > 13 indicates homology
NNLLNFKMAK + Oxidation (M); 2 Deamidated (NQ)
3529 1059.5486 2117.0826 2117.0609 10.3 1 6 0.31 +1Score > 23 indicates identity
Score > 13 indicates homology
GVVMLERDVEQATLAEMAR
2541 328.5127 982.5163 982.4906 26.1 1 6 0.5 +1Score > 21 indicates identity
Score > 15 indicates homology
QKVGTCYK
2808 615.3568 1228.6990 1228.6411 47.2 1 5 0.84 +1Score > 21 indicates identity
Score > 17 indicates homology
RNLLEQIQGR + 3 Deamidated (NQ)
3572 713.3563 2137.0471 2137.1354 -41.3 1 5 0.5 +1Score > 23 indicates identity
Score > 15 indicates homology
FMGVAAERIAEGAFLLALSR + Oxidation (M)
2612 350.5461 1048.6165 1048.6505 -32.5 1 5 0.97 +1Score > 18 indicates identity VARLVPAPAR
2436 450.2217 898.4288 898.4443 -17.2 1 5 1 +1Score > 18 indicates identity MRGHQAAK + Deamidated (NQ)
2814 412.2435 1233.7087 1233.6717 30.0 1 5 1.1 +1Score > 18 indicates identity IKAAGVDYELR
3017 725.8655 1449.7164 1449.6736 29.6 0 5 1 +1Score > 23 indicates identity
Score > 18 indicates homology
ELVLFDDQSNNR + Deamidated (NQ)
4130 810.9464 3239.7565 3239.7336 7.08 1 5 1.3 +1Score > 19 indicates identity RQAKPEHKPSLEELLEMLVEQALAVQPR + Deamidated (NQ)
2483 470.7395 939.4644 939.4662 -1.82 1 5 0.85 +1Score > 20 indicates identity
Score > 17 indicates homology
FSSQTKDK
3789 800.3928 2398.1566 2398.2315 -31.2 1 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology
QMQSNLGQKTWAPSAVPLELGK + Oxidation (M)
2373 393.2300 784.4454 784.4807 -44.9 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
LLSPSLR
3774 1192.1017 2382.1888 2382.1452 18.3 0 5 1 +1Score > 23 indicates identity
Score > 18 indicates homology
APDDLLDHLENTIGGAGADYVAR
3029 730.4235 1458.8324 1458.7653 46.0 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology
MANLGLANLIAWR + Oxidation (M); Deamidated (NQ)
2947 694.3525 1386.6904 1386.7103 -14.3 1 5 0.91 +1Score > 23 indicates identity
Score > 17 indicates homology
ERAALVLESEDR
2828 415.8985 1244.6737 1244.6625 8.95 1 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology
RSSWLEQALR
3979 895.4396 2683.2970 2683.2356 22.9 1 5 0.72 +1Score > 23 indicates identity
Score > 16 indicates homology
QRLQQNITQMDNMIGQVLDYLR + 7 Deamidated (NQ)
3224 402.6898 1606.7301 1606.6722 36.0 0 5 1 +1Score > 21 indicates identity
Score > 18 indicates homology
AFSSMENFTNWTR + Oxidation (M); Deamidated (NQ)
3125 761.9093 1521.8040 1521.7688 23.2 1 5 0.85 +1Score > 22 indicates identity
Score > 17 indicates homology
IAGFARGYSAQPER
2395 407.7617 813.5088 813.5072 2.00 0 5 0.96 +1Score > 22 indicates identity
Score > 18 indicates homology
LATLLQR
2658 363.8639 1088.5699 1088.5614 7.74 1 5 1 +1Score > 23 indicates identity
Score > 18 indicates homology
PTPRQFSQK + Deamidated (NQ)
3793 802.3994 2404.1764 2404.1118 26.9 0 5 0.7 +1Score > 22 indicates identity
Score > 16 indicates homology
YTDNFGKPHTLTEDQMVHVR + Oxidation (M); Deamidated (NQ)
3303 585.9496 1754.8270 1754.8111 9.04 1 5 0.96 +1Score > 21 indicates identity
Score > 17 indicates homology
ADATLAYAWGKNSSDGK + Deamidated (NQ)
4006 918.8046 2753.3920 2753.4025 -3.81 1 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology
LNVVIGDEDPLGSFVFRTTGFNSIR + Deamidated (NQ)
2695 566.2484 1130.4822 1130.5067 -21.6 0 5 0.83 +1Score > 17 indicates identity ITFEGDFMR + Oxidation (M)
3097 377.4186 1505.6453 1505.6456 -0.22 0 5 1.1 +1Score > 18 indicates identity MADWQSLDPEAAR + Oxidation (M); Deamidated (NQ)
3312 880.9843 1759.9540 1759.9468 4.11 1 5 0.77 +1Score > 21 indicates identity
Score > 16 indicates homology
ALRSVQTLFEELTPR + Deamidated (NQ)
3532 1060.0438 2118.0730 2118.1031 -14.2 0 5 0.43 +1Score > 23 indicates identity
Score > 14 indicates homology
IFQEASPAISGVIQGAMILR + Oxidation (M); 2 Deamidated (NQ)
2858 634.8193 1267.6240 1267.6448 -16.4 0 5 1 +1Score > 21 indicates identity
Score > 18 indicates homology
VPSQYYLELR + Deamidated (NQ)
3715 1155.1138 2308.2130 2308.1429 30.4 1 5 0.42 +1Score > 22 indicates identity
Score > 14 indicates homology
MPARCRPWSRPAAGVPGTDAR
2784 404.1928 1209.5566 1209.5513 4.35 0 5 0.75 +1Score > 21 indicates identity
Score > 16 indicates homology
GITYNQEDLR + 2 Deamidated (NQ)
3386 656.4133 1966.2181 1966.1211 49.3 1 5 0.32 +1Score > 13 indicates identity LREALATVNGELQALVLR + Deamidated (NQ)
2804 409.8906 1226.6500 1226.6870 -30.2 0 5 0.76 +1Score > 23 indicates identity
Score > 16 indicates homology
DPASVQLLAVSK
3616 720.3905 2158.1497 2158.1019 22.2 0 5 1 +1Score > 21 indicates identity
Score > 17 indicates homology
VFVVNADAIGGIGSSVANSGPAR + Deamidated (NQ)
3351 929.4721 1856.9296 1856.8938 19.3 0 5 0.65 +1Score > 23 indicates identity
Score > 16 indicates homology
TVNALEIELQAQHSMR + Oxidation (M); 2 Deamidated (NQ)
3675 563.0315 2248.0969 2248.1964 -44.3 1 5 0.44 +1Score > 23 indicates identity
Score > 14 indicates homology
LGLRYDIRPDLQVYGNLSR + Deamidated (NQ)
3944 873.4637 2617.3693 2617.4223 -20.3 0 5 1 +1Score > 21 indicates identity
Score > 17 indicates homology
LAQTPSVQPVLMDIEMPLVPVLAR + Deamidated (NQ)
2581 511.7936 1021.5726 1021.6033 -30.0 0 5 1.5 +1Score > 19 indicates identity LAQSVVLHR
4256 696.1851 3475.8891 3475.8021 25.0 0 5 1.3 +1Score > 18 indicates identity TAQIAEAAGIALYGGTMLEGSIGTLASAHAFLTLR + Deamidated (NQ)
3165 518.2757 1551.8053 1551.7524 34.1 0 5 1 +1Score > 22 indicates identity
Score > 17 indicates homology
LMPVMAVSNSTLQK + 2 Oxidation (M); 2 Deamidated (NQ)
2726 579.7950 1157.5754 1157.5605 13.0 0 5 1 +1Score > 23 indicates identity
Score > 17 indicates homology
FSVAQTETFK + Deamidated (NQ)
3930 864.7540 2591.2402 2591.3278 -33.8 1 5 0.4 +1Score > 22 indicates identity
Score > 13 indicates homology
VVAGDQAAGAQLQEMLRPFVYRR + Oxidation (M); Deamidated (NQ)
2465 929.5356 928.5283 928.5025 27.8 1 5 1 +1Score > 23 indicates identity
Score > 17 indicates homology
RMRPTPR + Oxidation (M)
2961 474.2385 1419.6937 1419.7279 -24.1 1 5 0.51 +1Score > 23 indicates identity
Score > 14 indicates homology
IDTMTTSPADLKK
2210 303.1599 604.3052 604.3003 8.25 0 5 0.75 +1Score > 22 indicates identity
Score > 16 indicates homology
LEGMR
1882 433.2208 432.2135 432.2332 -45.6 0 5 0.59 +1Score > 23 indicates identity
Score > 15 indicates homology
GATGK
2350 759.4652 758.4579 758.4286 38.6 1 5 1 +1Score > 22 indicates identity
Score > 17 indicates homology
KVQQQK + Deamidated (NQ)
2675 552.8275 1103.6404 1103.5975 38.9 0 5 1.6 +1Score > 19 indicates identity FVVAEPSTVR
2594 344.1875 1029.5407 1029.4992 40.3 1 5 1 +1Score > 23 indicates identity
Score > 17 indicates homology
RAEHENFK
2827 623.3426 1244.6706 1244.6448 20.8 1 5 0.41 +1Score > 22 indicates identity
Score > 13 indicates homology
ARLLMQWGDR
3134 508.6099 1522.8079 1522.8355 -18.1 0 5 0.45 +1Score > 21 indicates identity
Score > 14 indicates homology
QAPVVANNVLVALGR + 3 Deamidated (NQ)
3791 801.7528 2402.2366 2402.1965 16.7 0 5 1 +1Score > 22 indicates identity
Score > 17 indicates homology
IGDSDNHVQLLEPLSPESPVQK + Deamidated (NQ)
3586 714.3895 2140.1467 2140.1099 17.2 1 5 0.52 +1Score > 22 indicates identity
Score > 14 indicates homology
LINGVVDPLSGAHMLERYR + Deamidated (NQ)
2388 403.2516 804.4886 804.4857 3.60 0 5 1 +1Score > 17 indicates identity LIYQIR
3098 502.8891 1505.6455 1505.6529 -4.91 1 5 1.2 +1Score > 18 indicates identity AGRDQTDVAAEGCR + Deamidated (NQ)
3256 546.6234 1636.8484 1636.8072 25.2 0 5 0.91 +1Score > 22 indicates identity
Score > 17 indicates homology
ADMLHFPLEFFVR + Oxidation (M)
3423 674.3920 2020.1542 2020.1429 5.59 1 5 1 +1Score > 17 indicates identity VNVNIIGLDGRPQLKNLR + 2 Deamidated (NQ)
3071 495.6025 1483.7857 1483.7743 7.67 1 5 0.53 +1Score > 22 indicates identity
Score > 14 indicates homology
LAADGSPLSGGQKQR
2295 673.3572 672.3499 672.3483 2.46 0 5 0.52 +1Score > 22 indicates identity
Score > 14 indicates homology
ELPFAP
3486 1050.5679 2099.1212 2099.0535 32.3 1 5 0.39 +1Score > 21 indicates identity
Score > 13 indicates homology
ILLDGQPVTDFDPDQLRR + 2 Deamidated (NQ)
3751 786.7573 2357.2501 2357.1711 33.5 0 5 0.74 +1Score > 22 indicates identity
Score > 16 indicates homology
EQLDQVGSGGVTGATGLLGNNLVR + 3 Deamidated (NQ)
4371 1055.5538 4218.1861 4218.0038 43.2 1 5 1.6 +1Score > 19 indicates identity AIAPNAVNVNFYGTTETPQAMAFHTLDPEMDNARVPLGK + Oxidation (M); 2 Deamidated (NQ)
3465 695.6404 2083.8994 2083.9741 -35.8 0 4 1.4 +1Score > 18 indicates identity MVFNGGALIGCDLGTMNVAK + Oxidation (M); Deamidated (NQ)
2475 469.7269 937.4392 937.4559 -17.7 0 4 0.9 +1Score > 20 indicates identity
Score > 17 indicates homology
FAHFNFR
2585 342.4850 1024.4332 1024.4317 1.39 0 4 1 +1Score > 17 indicates identity MQESVMQR + Oxidation (M); Deamidated (NQ)
2901 661.8522 1321.6898 1321.7103 -15.4 0 4 0.75 +1Score > 22 indicates identity
Score > 16 indicates homology
ATGELHVAGVGVGR
3555 1064.5342 2127.0538 2127.0419 5.63 0 4 0.55 +1Score > 23 indicates identity
Score > 14 indicates homology
AQIPHSIPTQTQGLFMNSR + 2 Deamidated (NQ)
2720 1150.5631 1149.5558 1149.5124 37.8 0 4 0.88 +1Score > 22 indicates identity
Score > 16 indicates homology
LWEMAENTR + Deamidated (NQ)
3127 508.2764 1521.8074 1521.7973 6.61 0 4 0.68 +1Score > 22 indicates identity
Score > 15 indicates homology
ALANTLACASVYLR
2166 552.2673 551.2600 551.2591 1.66 0 4 1.2 +1Score > 18 indicates identity AQYGI + Deamidated (NQ)
3617 1080.5059 2158.9972 2159.1018 -48.4 1 4 0.44 +1Score > 21 indicates identity
Score > 13 indicates homology
AFMARGGQLQNNRPVTDIR + Oxidation (M)
3781 479.6424 2393.1756 2393.1910 -6.43 1 4 0.59 +1Score > 22 indicates identity
Score > 15 indicates homology
HAGVFSVASEVQPGAQHVAAMRK + Oxidation (M); Deamidated (NQ)
2952 702.8976 1403.7806 1403.7409 28.3 0 4 0.55 +1Score > 20 indicates identity
Score > 14 indicates homology
FADGVATLLDAGVR
3466 1042.9579 2083.9012 2083.9741 -34.9 0 4 1.5 +1Score > 19 indicates identity MVFNGGALIGCDLGTMNVAK + Oxidation (M); Deamidated (NQ)
4046 955.4936 2863.4590 2863.5014 -14.8 1 4 1 +1Score > 22 indicates identity
Score > 17 indicates homology
LPSPHLLKQQMPLPSELAQQVQAHR + Oxidation (M); 2 Deamidated (NQ)
2933 454.2441 1359.7105 1359.7034 5.20 1 4 1 +1Score > 23 indicates identity
Score > 17 indicates homology
VEENPQLQKFK + Deamidated (NQ)
2214 607.2546 606.2473 606.2544 -11.7 0 4 0.77 +1Score > 16 indicates identity AGSCGR
2851 633.8958 1265.7770 1265.7278 38.9 1 4 0.51 +1Score > 14 indicates identity ACLPLLRAQPK
2863 425.8691 1274.5855 1274.5826 2.23 0 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
NCVTAVGFDHR
3830 822.7805 2465.3197 2465.3770 -23.2 0 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
IWQIVWAVAGMVGLVAGLLWGAR
3503 703.0349 2106.0829 2106.0229 28.5 1 4 0.41 +1Score > 23 indicates identity
Score > 13 indicates homology
GVTRQAGNEIDEFVTEALR + 2 Deamidated (NQ)
4404 871.4581 4352.2541 4352.1039 34.5 0 4 1.7 +1Score > 19 indicates identity QAAAAPSTPVEQQGGQPLAGLQVLCVDNEDSILIGMNSLLSR + 5 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9  44 Next 

Not what you expected? Try the select summary.