MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Andy2682a |
| MS data file | : | Andy2682a.mgf |
| Database | : | P-putida 20180924 (5,556 sequences; 1,892,173 residues) |
| Timestamp | : | 2 Aug 2026 at 00:52:38 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Oxidation (M), Deamidated (NQ) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 50 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | Default |
| Number of queries | : | 4,656 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2530 |
327.1672 | 978.4798 | 978.5056 | -26.3 | 1 | 8 | 0.42 | 1Score > 22 indicates identity Score > 17 indicates homology |
MVKQIESK + Oxidation (M); Deamidated (NQ) |
| 2830 |
623.8493 | 1245.6840 | 1245.7121 | -22.5 | 0 | 8 | 0.77 | 1Score > 22 indicates identity Score > 20 indicates homology |
ILEFLAVGAWK |
| 2651 |
542.3137 | 1082.6128 | 1082.6560 | -39.9 | 1 | 8 | 0.52 | 1Score > 20 indicates identity Score > 18 indicates homology |
GVRLADIALR |
| 2669 |
549.7789 | 1097.5432 | 1097.5427 | 0.53 | 1 | 8 | 0.66 | 1Score > 21 indicates identity Score > 19 indicates homology |
YMLKVNDAK + Oxidation (M); Deamidated (NQ) |
| 3011 |
483.5616 | 1447.6630 | 1447.6976 | -24.0 | 1 | 8 | 0.75 | 1Score > 21 indicates identity Score > 20 indicates homology |
EELVQAAEKQMR + Oxidation (M); Deamidated (NQ) |
| 3081 |
373.7039 | 1490.7865 | 1490.8569 | -47.2 | 0 | 8 | 0.51 | 1Score > 23 indicates identity Score > 18 indicates homology |
LVVVGVAGGNLHSIR + Deamidated (NQ) |
| 3207 |
531.2604 | 1590.7594 | 1590.7372 | 13.9 | 0 | 8 | 0.29 | 1Score > 23 indicates identity Score > 15 indicates homology |
SSAELAQETANAAAQK + 2 Deamidated (NQ) |
| 2713 |
1146.7203 | 1145.7130 | 1145.7060 | 6.16 | 0 | 8 | 0.15 | 1Score > 13 indicates identity |
QSLILAILFK + Deamidated (NQ) |
| 2829 |
623.8182 | 1245.6218 | 1245.6023 | 15.7 | 0 | 8 | 0.69 | 1Score > 23 indicates identity Score > 19 indicates homology |
IVEDMQDGLAR |
| 2079 |
487.3359 | 486.3286 | 486.3166 | 24.8 | 0 | 8 | 1 | 1Score > 22 indicates identity Score > 21 indicates homology |
VGLAK |
| 3032 |
731.8321 | 1461.6496 | 1461.6848 | -24.0 | 1 | 8 | 0.66 | 1Score > 20 indicates identity Score > 19 indicates homology |
EYDAQPRDLQAR + Deamidated (NQ) |
| 2421 |
435.7758 | 869.5370 | 869.5123 | 28.4 | 0 | 8 | 0.65 | 1Score > 19 indicates identity |
VTVPWLR |
| 3211 |
797.9275 | 1593.8404 | 1593.8185 | 13.8 | 0 | 8 | 0.28 | 1Score > 21 indicates identity Score > 15 indicates homology |
TTFAMNLVENAVLR + Oxidation (M) |
| 3505 |
527.7741 | 2107.0673 | 2106.9759 | 43.4 | 0 | 8 | 0.96 | 1Score > 23 indicates identity Score > 20 indicates homology |
GNQPQPYQVDGQTWYGIR + Deamidated (NQ) |
| 2785 |
303.3965 | 1209.5569 | 1209.5560 | 0.70 | 0 | 8 | 0.75 | 1Score > 21 indicates identity Score > 19 indicates homology |
MAAGSNQTFQR |
| 3575 |
713.3634 | 2137.0684 | 2136.9716 | 45.3 | 0 | 8 | 0.91 | 1Score > 23 indicates identity Score > 20 indicates homology |
DLQMPPPGMLLFGGMMVNR + 2 Oxidation (M); 2 Deamidated (NQ) |
| 2354 |
767.3519 | 766.3446 | 766.3643 | -25.7 | 1 | 8 | 0.75 | 1Score > 19 indicates identity |
MKTTDR + Oxidation (M) |
| 2638 |
358.1949 | 1071.5629 | 1071.5171 | 42.7 | 1 | 8 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
CFKAYDIR |
| 2528 |
489.2591 | 976.5036 | 976.5342 | -31.3 | 0 | 8 | 0.9 | 1Score > 23 indicates identity Score > 20 indicates homology |
FAGQQLSVK |
| 3316 |
588.6285 | 1762.8637 | 1762.9141 | -28.6 | 0 | 8 | 0.26 | 1Score > 23 indicates identity Score > 14 indicates homology |
SEPDQDLLLFLFGLR + Deamidated (NQ) |
| 3206 |
398.6971 | 1590.7593 | 1590.7372 | 13.9 | 0 | 8 | 1 | 1Score > 23 indicates identity Score > 20 indicates homology |
SSAELAQETANAAAQK + 2 Deamidated (NQ) |
| 2359 |
387.6893 | 773.3640 | 773.3668 | -3.51 | 0 | 8 | 0.24 | 1Score > 21 indicates identity Score > 14 indicates homology |
IDGQNAR + Deamidated (NQ) |
| 2547 |
331.2091 | 990.6055 | 990.5723 | 33.5 | 1 | 8 | 0.2 | 1Score > 13 indicates identity |
RLPALHQR + Deamidated (NQ) |
| 2996 |
720.8574 | 1439.7002 | 1439.6523 | 33.3 | 0 | 8 | 0.33 | 1Score > 21 indicates identity Score > 15 indicates homology |
LSLEEMMVQSEK + Oxidation (M); Deamidated (NQ) |
| 2560 |
498.7827 | 995.5508 | 995.5110 | 40.0 | 0 | 8 | 0.78 | 1Score > 19 indicates identity |
VLMQGAFSK + Oxidation (M) |
| 2645 |
360.2308 | 1077.6706 | 1077.6182 | 48.6 | 1 | 8 | 0.26 | 1Score > 14 indicates identity |
LFTQTAIKR + Deamidated (NQ) |
| 3003 |
722.3531 | 1442.6916 | 1442.6898 | 1.31 | 1 | 8 | 0.67 | 1Score > 22 indicates identity Score > 18 indicates homology |
VMKNDISQMFAK + 2 Oxidation (M) |
| 2862 |
424.2188 | 1269.6346 | 1269.6830 | -38.1 | 1 | 8 | 0.82 | 1Score > 22 indicates identity Score > 19 indicates homology |
LESWRQGPLGK |
| 2411 |
421.2323 | 840.4500 | 840.4341 | 18.9 | 0 | 8 | 0.85 | 1Score > 19 indicates identity |
ATVAHELT |
| 3039 |
733.3438 | 1464.6730 | 1464.7177 | -30.5 | 1 | 7 | 0.77 | 1Score > 22 indicates identity Score > 19 indicates homology |
MVSLMTQDARAAR + Oxidation (M) |
| 3395 |
660.3352 | 1977.9838 | 1977.9578 | 13.1 | 1 | 7 | 0.37 | 1Score > 23 indicates identity Score > 16 indicates homology |
AYGAVRMGLIDNVDQAAGR + 2 Deamidated (NQ) |
| 2570 |
504.8038 | 1007.5930 | 1007.5624 | 30.4 | 1 | 7 | 0.49 | 1Score > 17 indicates identity |
ALRDHGIAR |
| 2618 |
526.3320 | 1050.6494 | 1050.6590 | -9.06 | 1 | 7 | 0.18 | 1Score > 13 indicates identity |
LVYKLFIR |
| 3064 |
741.3700 | 1480.7254 | 1480.7232 | 1.55 | 0 | 7 | 0.74 | 1Score > 22 indicates identity Score > 19 indicates homology |
VADMVIQAEYVAR + Oxidation (M); Deamidated (NQ) |
| 2364 |
779.4057 | 778.3984 | 778.4337 | -45.3 | 1 | 7 | 0.44 | 1Score > 22 indicates identity Score > 16 indicates homology |
LREYAK |
| 2881 |
647.8303 | 1293.6460 | 1293.6564 | -8.04 | 1 | 7 | 0.22 | 1Score > 23 indicates identity Score > 13 indicates homology |
DPVKALQQHEK + 2 Deamidated (NQ) |
| 2360 |
776.3870 | 775.3797 | 775.3898 | -13.0 | 0 | 7 | 0.51 | 1Score > 21 indicates identity Score > 17 indicates homology |
MQLINR + 2 Deamidated (NQ) |
| 2606 |
523.7635 | 1045.5124 | 1045.5161 | -3.48 | 1 | 7 | 0.66 | 1Score > 23 indicates identity Score > 18 indicates homology |
MSKIMHAGR + Oxidation (M) |
| 2824 |
623.3082 | 1244.6018 | 1244.5884 | 10.8 | 1 | 7 | 0.73 | 1Score > 23 indicates identity Score > 18 indicates homology |
LKGSPEDNEQK + Deamidated (NQ) |
| 3582 |
535.5181 | 2138.0433 | 2138.1154 | -33.7 | 1 | 7 | 0.31 | 1Score > 22 indicates identity Score > 15 indicates homology |
QSAVLDCHKGITLALANAVR + 2 Deamidated (NQ) |
| 2521 |
486.2684 | 970.5222 | 970.5447 | -23.2 | 1 | 7 | 0.25 | 1Score > 22 indicates identity Score > 14 indicates homology |
QQTPKIQK + Deamidated (NQ) |
| 2787 |
404.5465 | 1210.6177 | 1210.6095 | 6.78 | 1 | 7 | 0.95 | 1Score > 22 indicates identity Score > 20 indicates homology |
RFYDQGGLAGK |
| 2522 |
486.2684 | 970.5222 | 970.5447 | -23.2 | 0 | 7 | 0.75 | 1Score > 22 indicates identity Score > 18 indicates homology |
NGLLSPVGSK |
| 2569 |
504.8038 | 1007.5930 | 1007.5624 | 30.4 | 1 | 7 | 0.53 | 1Score > 17 indicates identity |
ALRDHGIAR |
| 2375 |
393.2310 | 784.4474 | 784.4807 | -42.3 | 0 | 7 | 0.81 | 1Score > 20 indicates identity Score > 19 indicates homology |
EALIALR |
| 2807 |
410.5735 | 1228.6987 | 1228.6815 | 13.9 | 0 | 7 | 0.35 | 1Score > 21 indicates identity Score > 15 indicates homology |
LVQFLQLNPR + 2 Deamidated (NQ) |
| 2559 |
332.8574 | 995.5504 | 995.5764 | -26.1 | 0 | 7 | 0.89 | 1Score > 19 indicates identity |
IGLLGPNGAGK |
| 3258 |
825.3630 | 1648.7114 | 1648.7072 | 2.56 | 0 | 7 | 0.87 | 1Score > 19 indicates identity |
MSNPNEDSPMILQR + Oxidation (M); 2 Deamidated (NQ) |
| 3771 |
794.0867 | 2379.2383 | 2379.1554 | 34.8 | 0 | 7 | 1 | 1Score > 22 indicates identity Score > 20 indicates homology |
QLYGGQVLGQSLSAASQTVEDAR + 2 Deamidated (NQ) |
| 2508 |
481.3021 | 960.5896 | 960.5426 | 49.0 | 1 | 7 | 0.35 | 1Score > 15 indicates identity |
MTELARLK |
| 3324 |
594.6446 | 1780.9120 | 1780.8665 | 25.5 | 0 | 7 | 0.3 | 1Score > 23 indicates identity Score > 14 indicates homology |
AAAADIQAHLEQVAMPK + Oxidation (M); 2 Deamidated (NQ) |
| 2365 |
390.2435 | 778.4724 | 778.4337 | 49.8 | 1 | 7 | 0.7 | 1Score > 18 indicates identity |
LAREYK |
| 2384 |
801.4082 | 800.4009 | 800.4028 | -2.35 | 0 | 7 | 0.49 | 1Score > 21 indicates identity Score > 16 indicates homology |
LQPEASR + Deamidated (NQ) |
| 2588 |
1027.5714 | 1026.5641 | 1026.5280 | 35.1 | 0 | 7 | 0.56 | 1Score > 21 indicates identity Score > 17 indicates homology |
HCTLVLQR + Deamidated (NQ) |
| 2743 |
590.2957 | 1178.5768 | 1178.5819 | -4.28 | 0 | 7 | 0.33 | 1Score > 22 indicates identity Score > 15 indicates homology |
IVEANVDYEK |
| 2841 |
313.1972 | 1248.7597 | 1248.7302 | 23.6 | 1 | 7 | 0.26 | 1Score > 14 indicates identity |
DHLLLERVVR |
| 3188 |
784.4467 | 1566.8788 | 1566.8504 | 18.1 | 0 | 7 | 0.38 | 1Score > 20 indicates identity Score > 15 indicates homology |
QLAQELDLVLEAPK + Deamidated (NQ) |
| 2595 |
515.7779 | 1029.5412 | 1029.5567 | -15.0 | 1 | 7 | 0.37 | 1Score > 23 indicates identity Score > 15 indicates homology |
RIITDAEGR |
| 2962 |
710.8606 | 1419.7066 | 1419.7544 | -33.6 | 1 | 7 | 0.26 | 1Score > 23 indicates identity Score > 14 indicates homology |
LLNLFNEMRAAK + Deamidated (NQ) |
| 3740 |
782.0679 | 2343.1819 | 2343.1165 | 27.9 | 1 | 7 | 0.34 | 1Score > 23 indicates identity Score > 15 indicates homology |
MLDDLLEGRDGQLLANPHYR + Oxidation (M); 2 Deamidated (NQ) |
| 2575 |
338.1900 | 1011.5482 | 1011.5964 | -47.7 | 1 | 7 | 0.87 | 1Score > 20 indicates identity Score > 19 indicates homology |
NIPLKLQGK + 2 Deamidated (NQ) |
| 3345 |
923.9700 | 1845.9254 | 1845.8679 | 31.2 | 0 | 7 | 0.29 | 1Score > 23 indicates identity Score > 14 indicates homology |
LFQHTLECGNITAGAGR + 2 Deamidated (NQ) |
| 3658 |
737.0723 | 2208.1951 | 2208.2154 | -9.21 | 0 | 7 | 0.23 | 1Score > 20 indicates identity Score > 13 indicates homology |
QVQVVFQLQPEAQLTPLLR + 2 Deamidated (NQ) |
| 2058 |
476.2272 | 475.2199 | 475.2390 | -40.2 | 0 | 7 | 0.54 | 1Score > 24 indicates identity Score > 17 indicates homology |
NAGSK |
| 2794 |
610.3480 | 1218.6814 | 1218.6278 | 44.0 | 0 | 7 | 1 | 1Score > 21 indicates identity Score > 19 indicates homology |
LAMLDAATELR + Oxidation (M) |
| 3175 |
780.8845 | 1559.7544 | 1559.7614 | -4.43 | 0 | 7 | 1 | 1Score > 23 indicates identity Score > 19 indicates homology |
AMDQGVVVINIDNR + Oxidation (M); Deamidated (NQ) |
| 2368 |
781.4485 | 780.4412 | 780.4395 | 2.23 | 0 | 7 | 0.71 | 1Score > 18 indicates identity |
LWAVHR |
| 2845 |
632.3617 | 1262.7088 | 1262.6652 | 34.5 | 1 | 7 | 0.49 | 1Score > 20 indicates identity Score > 16 indicates homology |
TQQRLLSLMR + Oxidation (M); 2 Deamidated (NQ) |
| 2944 |
693.3516 | 1384.6886 | 1384.6946 | -4.33 | 0 | 7 | 0.41 | 1Score > 22 indicates identity Score > 15 indicates homology |
LSDDLQNLNPTR |
| 3297 |
871.9619 | 1741.9092 | 1741.9210 | -6.72 | 1 | 7 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
QALQEAEISLANAKQK + Deamidated (NQ) |
| 3073 |
496.6014 | 1486.7824 | 1486.8103 | -18.8 | 1 | 7 | 0.71 | 1Score > 23 indicates identity Score > 18 indicates homology |
LAGLTATEQRAVTR + Deamidated (NQ) |
| 3159 |
772.8954 | 1543.7762 | 1543.7842 | -5.15 | 1 | 7 | 0.46 | 1Score > 23 indicates identity Score > 16 indicates homology |
KTLDTQTGQPVEAR + Deamidated (NQ) |
| 2175 |
563.2627 | 562.2554 | 562.2347 | 36.9 | 0 | 7 | 0.58 | 1Score > 20 indicates identity Score > 17 indicates homology |
NSDAR + Deamidated (NQ) |
| 2737 |
391.2145 | 1170.6217 | 1170.5921 | 25.3 | 0 | 7 | 0.32 | 1Score > 23 indicates identity Score > 14 indicates homology |
QQAYLATTFK + Deamidated (NQ) |
| 3053 |
739.8190 | 1477.6234 | 1477.6547 | -21.2 | 0 | 7 | 0.79 | 1Score > 18 indicates identity |
AIEQFMQQYYR + 2 Deamidated (NQ) |
| 2688 |
559.8070 | 1117.5994 | 1117.5563 | 38.6 | 1 | 7 | 0.27 | 1Score > 23 indicates identity Score > 13 indicates homology |
HDIPMGRHR |
| 3390 |
657.3741 | 1969.1005 | 1969.0619 | 19.6 | 0 | 6 | 0.97 | 1Score > 19 indicates identity |
LDLLTAEVVESLNAILQQ + Deamidated (NQ) |
| 2607 |
349.5116 | 1045.5130 | 1045.5161 | -2.98 | 1 | 6 | 0.49 | 1Score > 23 indicates identity Score > 16 indicates homology |
MSKIMHAGR + Oxidation (M) |
| 3803 |
810.0646 | 2427.1720 | 2427.1603 | 4.82 | 0 | 6 | 0.26 | 1Score > 23 indicates identity Score > 13 indicates homology |
FIGVGGPLMEAEGLQSYFPMER |
| 4096 |
769.6843 | 3074.7081 | 3074.6012 | 34.8 | 1 | 6 | 0.75 | 1Score > 18 indicates identity |
SVDQPWVRIPFPGAPEQGMLVIELPQR + Oxidation (M) |
| 2775 |
603.8010 | 1205.5874 | 1205.5677 | 16.4 | 0 | 6 | 0.42 | 1Score > 22 indicates identity Score > 15 indicates homology |
LAGTDPDYAQR |
| 2418 |
432.2532 | 862.4918 | 862.4582 | 39.0 | 0 | 6 | 0.44 | 1Score > 20 indicates identity Score > 15 indicates homology |
QVAMALSK + Oxidation (M) |
| 3343 |
462.2302 | 1844.8917 | 1844.8363 | 30.0 | 1 | 6 | 0.32 | 1Score > 23 indicates identity Score > 14 indicates homology |
QAQVFDSKAAQQYMGR + Oxidation (M); 2 Deamidated (NQ) |
| 2431 |
445.2635 | 888.5124 | 888.5029 | 10.8 | 1 | 6 | 0.85 | 1Score > 20 indicates identity Score > 18 indicates homology |
KDLLSSAR |
| 2871 |
640.8296 | 1279.6446 | 1279.6408 | 2.99 | 0 | 6 | 0.87 | 1Score > 22 indicates identity Score > 18 indicates homology |
ETGVDYSILAGR |
| 2188 |
581.3315 | 580.3242 | 580.3445 | -35.0 | 0 | 6 | 0.83 | 1Score > 18 indicates identity |
VGIHR |
| 2540 |
492.2650 | 982.5154 | 982.5600 | -45.3 | 1 | 6 | 0.9 | 1Score > 21 indicates identity Score > 18 indicates homology |
KFVIDPHK |
| 2964 |
475.2400 | 1422.6982 | 1422.6959 | 1.59 | 1 | 6 | 0.3 | 1Score > 22 indicates identity Score > 14 indicates homology |
GTTCKQIIQMAR + Oxidation (M); Deamidated (NQ) |
| 2630 |
533.7539 | 1065.4932 | 1065.5342 | -38.5 | 0 | 6 | 0.66 | 1Score > 21 indicates identity Score > 17 indicates homology |
ATYPSATVEK |
| 3146 |
512.2780 | 1533.8122 | 1533.8263 | -9.22 | 0 | 6 | 0.53 | 1Score > 23 indicates identity Score > 16 indicates homology |
IAEQAGIQALAVHGR + Deamidated (NQ) |
| 2911 |
662.8998 | 1323.7850 | 1323.8238 | -29.3 | 1 | 6 | 0.55 | 1Score > 16 indicates identity |
LEIARALGAVALK |
| 3828 |
821.7580 | 2462.2522 | 2462.2111 | 16.7 | 1 | 6 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
LPSIGGVNLSQMGNAQGAAEKQFK + Oxidation (M); 2 Deamidated (NQ) |
| 2887 |
652.3986 | 1302.7826 | 1302.7408 | 32.1 | 1 | 6 | 0.51 | 1Score > 16 indicates identity |
LAARNLFTELR |
| 4465 |
1185.6240 | 4738.4669 | 4738.3775 | 18.9 | 0 | 6 | 0.83 | 1Score > 18 indicates identity |
LQGQVFDLIFVNAGVMGPLPQDLEAVHNSDIGDLFMTNAVAPIR + Oxidation (M); Deamidated (NQ) |
| 2493 |
477.7101 | 953.4056 | 953.4427 | -38.9 | 1 | 6 | 0.67 | 1Score > 17 indicates identity |
QHNDQRR + Deamidated (NQ) |
| 2285 |
334.1528 | 666.2910 | 666.2829 | 12.2 | 0 | 6 | 0.67 | 1Score > 17 indicates identity |
MTPMR + 2 Oxidation (M) |
| 2534 |
981.3771 | 980.3698 | 980.4134 | -44.5 | 0 | 6 | 0.24 | 1Score > 13 indicates identity |
NSGSAGWMR + Oxidation (M) |
| 3826 |
821.7491 | 2462.2255 | 2462.2032 | 9.03 | 0 | 6 | 1 | 1Score > 22 indicates identity Score > 19 indicates homology |
MINAQLLQSMVDASNDGIVVAEK + Oxidation (M); Deamidated (NQ) |
| 2918 |
666.7899 | 1331.5652 | 1331.6292 | -48.0 | 1 | 6 | 0.79 | 1Score > 18 indicates identity |
VFAGPANDPKCR + Deamidated (NQ) |
| 3758 |
790.4091 | 2368.2055 | 2368.1349 | 29.8 | 1 | 6 | 0.35 | 1Score > 23 indicates identity Score > 14 indicates homology |
HYPQGAHFAHSVGYVGRINEK + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/