MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4336)

Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2538 982.4676 981.4603 981.4953 -35.7 0 11 0.46 +1Score > 21 indicates identity EMLFSALR + Oxidation (M)
2809 615.8308 1229.6470 1229.6517 -3.75 1 11 0.37 +1Score > 23 indicates identity
Score > 20 indicates homology		 LFGRGGQLPER + Deamidated (NQ)
2921 668.3400 1334.6654 1334.7016 -27.1 0 11 0.3 +1Score > 23 indicates identity
Score > 19 indicates homology		 GIVAEMFNALVR + Oxidation (M)
2353 767.3514 766.3441 766.3643 -26.4 1 11 0.36 +1Score > 19 indicates identity MKTTDR + Oxidation (M)
2993 480.5471 1438.6195 1438.6432 -16.5 0 11 0.33 +1Score > 19 indicates identity QMSPMSAEATVVR + 2 Oxidation (M); Deamidated (NQ)
2865 638.8250 1275.6354 1275.6975 -48.7 0 11 0.78 +1Score > 23 indicates identity
Score > 22 indicates homology		 VLAVAVYNHYK
3076 497.2783 1488.8131 1488.7824 20.6 0 11 0.25 +1Score > 22 indicates identity
Score > 17 indicates homology		 YSPLDLLNVNNVK + Deamidated (NQ)
3597 537.2602 2145.0117 2144.9870 11.5 1 11 0.13 +1Score > 23 indicates identity
Score > 14 indicates homology		 MKAEQMAADYQQLFGGLAR + Oxidation (M); 2 Deamidated (NQ)
2949 698.3628 1394.7110 1394.7517 -29.2 0 11 0.45 +1Score > 23 indicates identity
Score > 20 indicates homology		 GQAAAQPVIQAIAR + 2 Deamidated (NQ)
2768 399.9187 1196.7343 1196.6989 29.5 1 11 0.19 +1Score > 16 indicates identity NQGGQLLARIK
2481 314.1617 939.4633 939.4484 15.9 0 11 0.44 +1Score > 20 indicates identity AYNTALMR + Deamidated (NQ)
2999 720.8583 1439.7020 1439.6523 34.5 0 11 0.1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LSLEEMMVQSEK + Oxidation (M); Deamidated (NQ)
2472 467.7746 933.5346 933.5284 6.73 0 11 0.36 +1Score > 20 indicates identity
Score > 19 indicates homology		 FLLSTPTR
2870 426.9197 1277.7373 1277.6948 33.3 1 11 0.19 +1Score > 16 indicates identity RIGISMALVMR + 2 Oxidation (M)
2685 373.1721 1116.4945 1116.5047 -9.17 0 11 0.38 +1Score > 19 indicates identity SVEPGSQGAQR + 2 Deamidated (NQ)
3230 805.4181 1608.8216 1608.7916 18.7 0 11 0.22 +1Score > 23 indicates identity
Score > 17 indicates homology		 ALTVNTNITSMSVQK + 3 Deamidated (NQ)
2592 1028.5288 1027.5215 1027.5372 -15.3 0 11 0.57 +1Score > 21 indicates identity QPVMEPLAK + Oxidation (M)
2954 703.8578 1405.7010 1405.6403 43.2 0 11 0.11 +1Score > 22 indicates identity
Score > 14 indicates homology		 QALMAEHMALMK + 2 Oxidation (M); Deamidated (NQ)
2185 579.2925 578.2852 578.3098 -42.4 0 11 0.52 +1Score > 20 indicates identity MTIAK + Oxidation (M)
3222 535.9348 1604.7826 1604.7028 49.7 0 11 0.81 +1Score > 22 indicates identity YDLQMAQYDVESK + Oxidation (M)
3590 1072.5162 2143.0178 2143.0579 -18.7 1 11 0.14 +1Score > 23 indicates identity
Score > 15 indicates homology		 QGLDPRQASLQVNTLCALR + 4 Deamidated (NQ)
3287 854.3763 1706.7380 1706.7821 -25.8 0 11 0.39 +1Score > 19 indicates identity MSAINVFQQNPGAEAK + 3 Deamidated (NQ)
2239 623.3250 622.3177 622.3108 11.1 0 11 0.5 +1Score > 21 indicates identity
Score > 20 indicates homology		 LSMTR + Oxidation (M)
2687 373.5402 1117.5988 1117.5801 16.7 0 11 0.11 +1Score > 23 indicates identity
Score > 13 indicates homology		 NAQMVLDIAK + Oxidation (M)
2584 512.8005 1023.5864 1023.5964 -9.73 1 10 0.28 +1Score > 17 indicates identity LAISNPKALP + Deamidated (NQ)
2613 525.3158 1048.6170 1048.5917 24.2 0 10 0.3 +1Score > 18 indicates identity AGLPELPPQK
2941 688.8576 1375.7006 1375.6540 33.9 0 10 0.76 +1Score > 22 indicates identity EVMQIINAQQAK + 4 Deamidated (NQ)
2215 304.6627 607.3108 607.2999 18.0 0 10 0.36 +1Score > 19 indicates identity ASVGMK + Oxidation (M)
3163 774.4149 1546.8152 1546.7773 24.5 1 10 0.12 +1Score > 22 indicates identity
Score > 14 indicates homology		 SMNLVAEQKDALGR + Oxidation (M)
3579 1070.0176 2138.0206 2138.1154 -44.3 1 10 0.12 +1Score > 22 indicates identity
Score > 14 indicates homology		 QSAVLDCHKGITLALANAVR + 2 Deamidated (NQ)
2727 387.5647 1159.6723 1159.6673 4.28 1 10 0.42 +1Score > 19 indicates identity RLGLATSSVTR
2245 316.1540 630.2934 630.3085 -23.9 0 10 0.32 +1Score > 18 indicates identity QEAAGR
2457 461.2853 920.5560 920.5443 12.7 0 10 0.14 +1Score > 14 indicates identity LAVEHKPK
2668 366.8549 1097.5429 1097.5764 -30.5 1 10 0.12 +1Score > 21 indicates identity
Score > 14 indicates homology		 MGHALAAGARK + Oxidation (M)
2545 496.2477 990.4808 990.4627 18.4 0 10 0.89 +1Score > 22 indicates identity LEVSPCMR
3031 731.8318 1461.6490 1461.6848 -24.5 1 10 0.49 +1Score > 20 indicates identity ATDNPAEGFVERR + Deamidated (NQ)
2227 616.2892 615.2819 615.3089 -43.8 0 10 0.15 +1Score > 14 indicates identity QQQGR
2564 500.7692 999.5238 999.5713 -47.4 0 10 0.95 +1Score > 22 indicates identity QSALLALQR + Deamidated (NQ)
3190 523.6353 1567.8841 1567.8682 10.1 0 10 0.2 +1Score > 20 indicates identity
Score > 15 indicates homology		 ELAEQLGISRPSLR
2659 545.2930 1088.5714 1088.6243 -48.6 1 10 0.66 +1Score > 23 indicates identity
Score > 21 indicates homology		 FAQWLLRR
2847 632.8536 1263.6926 1263.6380 43.2 0 10 0.71 +1Score > 21 indicates identity MSNNLSLLLDK + Oxidation (M); Deamidated (NQ)
2642 360.2300 1077.6682 1077.6155 48.8 1 10 0.16 +1Score > 14 indicates identity HLRAQGLQR
3987 901.4555 2701.3447 2701.3096 13.0 1 10 0.25 +1Score > 23 indicates identity
Score > 16 indicates homology		 RASWQEAASSSLTELFAPQIHQSR + 2 Deamidated (NQ)
2643 360.2302 1077.6688 1077.6182 46.9 1 10 0.16 +1Score > 14 indicates identity LFTQTAIKR + Deamidated (NQ)
3502 527.5276 2106.0813 2106.1473 -31.4 0 10 0.58 +1Score > 23 indicates identity
Score > 20 indicates homology		 EPGAGFLLTNLIHDLDLLR
2321 354.7002 707.3858 707.3636 31.5 1 10 0.62 +1Score > 21 indicates identity
Score > 20 indicates homology		 MQKASK + Oxidation (M)
2859 635.3124 1268.6102 1268.5534 44.8 0 10 0.15 +1Score > 21 indicates identity
Score > 14 indicates homology		 EDGGHYGHLQR + Deamidated (NQ)
2241 312.6657 623.3168 623.3027 22.7 0 10 0.25 +1Score > 16 indicates identity NTAYR
3037 488.2264 1461.6574 1461.7034 -31.5 0 10 0.64 +1Score > 20 indicates identity VIAYDMLGHGQSR + Oxidation (M)
2844 631.3506 1260.6866 1260.7415 -43.5 1 10 0.27 +1Score > 22 indicates identity
Score > 16 indicates homology		 INQGKPPVPRR
2461 461.7914 921.5682 921.5508 18.9 1 10 0.12 +1Score > 13 indicates identity HLLVQRR + Deamidated (NQ)
3342 615.6363 1843.8871 1843.8846 1.33 1 10 0.32 +1Score > 23 indicates identity
Score > 17 indicates homology		 DSRDIEGELRPCIER
3765 476.6488 2378.2076 2378.2740 -27.9 1 10 1 +1Score > 22 indicates identity
Score > 22 indicates homology		 LPGSSGPLLRITHAAQVMGSTLR + Oxidation (M); Deamidated (NQ)
2741 587.2864 1172.5582 1172.5574 0.71 0 10 0.59 +1Score > 21 indicates identity
Score > 20 indicates homology		 LGYDEVHNAR
2832 624.7781 1247.5416 1247.5638 -17.8 0 10 0.53 +1Score > 19 indicates identity ELCEQGMPLR + Oxidation (M)
2517 485.7622 969.5098 969.5243 -14.9 1 9 0.43 +1Score > 20 indicates identity
Score > 18 indicates homology		 QELPRAQK + Deamidated (NQ)
1657 403.2320 402.2247 402.2227 5.10 0 9 1 +1Score > 28 indicates identity
Score > 22 indicates homology		 AGAGK
3201 528.2529 1581.7369 1581.7675 -19.3 0 9 0.5 +1Score > 22 indicates identity
Score > 19 indicates homology		 AQVEGLEGYPVYTR + Deamidated (NQ)
2690 560.2875 1118.5604 1118.6005 -35.8 0 9 0.16 +1Score > 23 indicates identity
Score > 14 indicates homology		 LLLAGDTSAMK
2381 791.4332 790.4259 790.4449 -24.1 1 9 0.73 +1Score > 22 indicates identity
Score > 21 indicates homology		 LRFAQR + Deamidated (NQ)
2922 669.8526 1337.6906 1337.7092 -13.8 1 9 0.22 +1Score > 22 indicates identity
Score > 15 indicates homology		 EEVIQYVFRR
2400 412.2569 822.4992 822.4824 20.5 1 9 0.21 +1Score > 15 indicates identity QIHRLR + Deamidated (NQ)
2331 716.3992 715.3919 715.3864 7.68 0 9 0.89 +1Score > 23 indicates identity
Score > 21 indicates homology		 IDLAER
2385 801.4526 800.4453 800.4756 -37.8 0 9 0.57 +1Score > 23 indicates identity
Score > 19 indicates homology		 LLLTGQR + Deamidated (NQ)
3228 536.9474 1607.8204 1607.7436 47.8 0 9 0.48 +1Score > 23 indicates identity
Score > 19 indicates homology		 YNTHLDLINMMSR + Deamidated (NQ)
3047 492.9130 1475.7172 1475.7593 -28.6 1 9 0.48 +1Score > 23 indicates identity
Score > 19 indicates homology		 SDTIHRVNHEIR
3371 639.6694 1915.9864 1916.0335 -24.6 1 9 0.19 +1Score > 22 indicates identity
Score > 14 indicates homology		 MRLMLLGGGNALGQALIR + 2 Oxidation (M); Deamidated (NQ)
3434 683.0214 2046.0424 2046.0382 2.06 1 9 0.42 +1Score > 23 indicates identity
Score > 18 indicates homology		 DGTVSAFENKLIVNASPER
2937 681.8708 1361.7270 1361.6714 40.9 1 9 1 +1Score > 22 indicates identity
Score > 22 indicates homology		 VEENPQLQKFK + 3 Deamidated (NQ)
3034 366.4201 1461.6513 1461.6848 -22.9 1 9 0.26 +1Score > 20 indicates identity
Score > 16 indicates homology		 EYDAQPRDLQAR + Deamidated (NQ)
3280 845.3830 1688.7514 1688.7312 12.0 0 9 0.78 +1Score > 21 indicates identity QLASDEMTDAGHIER + Oxidation (M); Deamidated (NQ)
4469 1186.6400 4742.5309 4742.3136 45.8 0 9 0.42 +1Score > 18 indicates identity LQGQVFDLIFVNAGVMGPLPQDLEAVHNSDIGDLFMTNAVAPIR + Oxidation (M); 5 Deamidated (NQ)
2511 962.5206 961.5133 961.5233 -10.3 0 9 0.52 +1Score > 22 indicates identity
Score > 19 indicates homology		 VLQAFVQR + 2 Deamidated (NQ)
3225 804.3727 1606.7308 1606.6722 36.5 0 9 0.23 +1Score > 21 indicates identity
Score > 15 indicates homology		 AFSSMENFTNWTR + Oxidation (M); Deamidated (NQ)
3609 539.2681 2153.0433 2153.0276 7.27 0 9 0.91 +1Score > 23 indicates identity
Score > 21 indicates homology		 EGAQVAFTYVSSAGPAEELAR + Deamidated (NQ)
3267 416.7365 1662.9169 1662.8577 35.6 0 9 0.22 +1Score > 21 indicates identity
Score > 15 indicates homology		 NSITEIDFINGSVVR
2721 575.7862 1149.5578 1149.5344 20.4 0 9 0.25 +1Score > 23 indicates identity
Score > 15 indicates homology		 MVDMAMPAIR + Oxidation (M)
3483 700.7121 2099.1145 2099.0535 29.0 1 9 0.29 +1Score > 21 indicates identity
Score > 16 indicates homology		 ILLDGQPVTDFDPDQLRR + 2 Deamidated (NQ)
3521 1058.9539 2115.8932 2115.9969 -49.0 0 9 0.41 +1Score > 18 indicates identity QYAPMSIADMALSLYAAER + Oxidation (M)
3150 384.7110 1534.8149 1534.8467 -20.7 0 9 1 +1Score > 23 indicates identity
Score > 21 indicates homology		 ALPTNAALALEPQAR
2577 507.7953 1013.5760 1013.6233 -46.6 0 9 0.7 +1Score > 22 indicates identity
Score > 20 indicates homology		 IAAVALTVTR
2905 441.5726 1321.6960 1321.7103 -10.8 0 9 1 +1Score > 22 indicates identity
Score > 21 indicates homology		 ATGELHVAGVGVGR
2677 557.8373 1113.6600 1113.6142 41.1 1 9 0.69 +1Score > 20 indicates identity ADGVVRVVDGK
3191 786.3654 1570.7162 1570.6643 33.1 0 9 0.82 +1Score > 20 indicates identity VFMGPEESMQVQR + 2 Oxidation (M); 2 Deamidated (NQ)
3684 567.0233 2264.0641 2264.1298 -29.0 1 9 0.82 +1Score > 23 indicates identity
Score > 20 indicates homology		 RHHEAIGQGDALNDVVLHPGK + 2 Deamidated (NQ)
3323 891.4621 1780.9096 1780.8227 48.8 1 9 0.63 +1Score > 23 indicates identity
Score > 19 indicates homology		 YRISDEGENAITEAGR + Deamidated (NQ)
3004 482.6303 1444.8691 1444.8150 37.4 1 9 0.18 +1Score > 14 indicates identity RVLQNFLTNALR + Deamidated (NQ)
2216 608.3882 607.3809 607.3693 19.1 1 9 0.14 +1Score > 13 indicates identity YLKGK
2471 467.2580 932.5014 932.4862 16.4 1 9 0.97 +1Score > 22 indicates identity
Score > 21 indicates homology		 MLLRDNR + Oxidation (M)
3352 621.2950 1860.8632 1860.8853 -11.9 0 9 0.5 +1Score > 21 indicates identity
Score > 18 indicates homology		 NDQSWLLSQTASLPSGR + 2 Deamidated (NQ)
2509 481.7274 961.4402 961.4716 -32.6 0 8 0.94 +1Score > 21 indicates identity
Score > 21 indicates homology		 TLQEEVSR + Deamidated (NQ)
2889 653.8354 1305.6562 1305.6533 2.24 1 8 1 +1Score > 23 indicates identity
Score > 21 indicates homology		 VMEGNLGRGVMK + Oxidation (M)
3189 784.9382 1567.8618 1567.8066 35.2 1 8 0.21 +1Score > 21 indicates identity
Score > 14 indicates homology		 QLLAQGDGSPQARAR + Deamidated (NQ)
3001 481.2426 1440.7060 1440.6456 41.9 1 8 0.8 +1Score > 22 indicates identity
Score > 20 indicates homology		 MAEANKAFSHYR + Oxidation (M); Deamidated (NQ)
2811 411.6003 1231.7791 1231.7176 49.9 0 8 0.14 +1Score > 13 indicates identity LVQGILADYLK
2748 593.3149 1184.6152 1184.6149 0.27 1 8 0.71 +1Score > 23 indicates identity
Score > 19 indicates homology		 TPRQGIDLQR + 2 Deamidated (NQ)
3007 482.8985 1445.6737 1445.6973 -16.3 0 8 0.26 +1Score > 21 indicates identity
Score > 15 indicates homology		 AQLQAFAPMQPAR + Oxidation (M); 2 Deamidated (NQ)
3504 1054.0499 2106.0852 2105.9840 48.1 0 8 1 +1Score > 23 indicates identity
Score > 21 indicates homology		 QDMPGLYYDNIHGNLALR + Oxidation (M); Deamidated (NQ)
2252 319.6918 637.3690 637.3772 -12.8 1 8 0.36 +1Score > 16 indicates identity GLHRR
3482 1050.5615 2099.1084 2099.0323 36.3 0 8 0.29 +1Score > 21 indicates identity
Score > 16 indicates homology		 WLDQPPAAAYAQAQDLLAR + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/