MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Andy2682a
MS data file : Andy2682a.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 2 Aug 2026 at 00:52:38 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,656

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 36)


Page: 1 2 3 4 Next 

-1

Accession Score Description
1 Q88JG7_PSEPK 5946 Alcohol dehydrogenase, iron-containing OS=Pseudomonas putida (strain KT2440) GN=PP_2682 PE=4 SV=1
Score Mass Matches Sequences emPAI
1.1 Q88JG7_PSEPK 5946 41896 204 (179) 35 (34) 935.41
Alcohol dehydrogenase, iron-containing OS=Pseudomonas putida (strain KT2440) GN=PP_2682 PE=4 SV=1

-204 peptide matches (109 non-duplicate, 95 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
2165   551.2968 550.2895 550.2863 5.78 0 29 0.0056 +1Score > 19 indicates identity U K.TFGAR.K
2247 +1 317.1621 632.3096 632.3064 5.09 0 23 0.041 +1Score > 22 indicates identity
Score > 22 indicates homology
U R.QICGR.L
2297   340.1997 678.3848 678.3813 5.23 1 28 0.0043 +1Score > 17 indicates identity U K.TFGARK.V
2299 +3 340.7026 679.3906 679.3905 0.26 0 42 0.00015 +1Score > 17 indicates identity U K.FSIVSK.A
2300 +2 680.3983 679.3910 679.3905 0.81 0 43 0.00014 +1Score > 17 indicates identity U K.FSIVSK.A
2447   916.4645 915.4572 915.4562 1.08 0 73 5.1e-007 +1Score > 23 indicates identity U R.HNVANYAK.T
2448   306.1602 915.4588 915.4562 2.77 0 32 0.0061 +1Score > 23 indicates identity U R.HNVANYAK.T
2449 +3 458.7368 915.4590 915.4562 3.07 0 61 5.6e-006 +1Score > 23 indicates identity
Score > 21 indicates homology
U R.HNVANYAK.T
2454 +1 459.2285 916.4424 916.4402 2.40 0 76 2.9e-007 +1Score > 23 indicates identity U R.HNVANYAK.T + Deamidated (NQ)
2456   461.2438 920.4730 920.4716 1.60 0 22 0.011 +1Score > 23 indicates identity
Score > 15 indicates homology
U M.SQSFSPLR.K
2477   470.2715 938.5284 938.5259 2.71 1 52 2.8e-005 +1Score > 19 indicates identity U R.MKFSIVSK.A
2478   313.8503 938.5291 938.5259 3.37 1 21 0.035 +1Score > 19 indicates identity U R.MKFSIVSK.A
2497 +2 319.1809 954.5209 954.5208 0.046 1 45 0.00017 +1Score > 20 indicates identity U R.MKFSIVSK.A + Oxidation (M)
2498   955.5292 954.5219 954.5208 1.15 1 54 1.6e-005 +1Score > 20 indicates identity
Score > 19 indicates homology
U R.MKFSIVSK.A + Oxidation (M)
2501 +2 478.2707 954.5268 954.5208 6.31 1 58 8.2e-006 +1Score > 20 indicates identity U R.MKFSIVSK.A + Oxidation (M)
2548   992.6003 991.5930 991.5927 0.33 0 58 3.4e-006 +1Score > 16 indicates identity U K.AIGIVVAHGR.S
2552 +3 331.5392 991.5958 991.5927 3.10 0 58 2.2e-006 +1Score > 14 indicates identity U K.AIGIVVAHGR.S
2553 +2 496.8056 991.5966 991.5927 3.98 0 71 1.2e-007 +1Score > 14 indicates identity U K.AIGIVVAHGR.S
2598   1035.6588 1034.6515 1034.6488 2.64 0 38 0.00015 +1Score > 13 indicates identity U R.LVEHLIALK.R
2599 +1 518.3334 1034.6522 1034.6488 3.34 0 70 1e-007 +1Score > 13 indicates identity U R.LVEHLIALK.R
2600 +1 345.8918 1034.6536 1034.6488 4.62 0 45 3.2e-005 +1Score > 13 indicates identity U R.LVEHLIALK.R
2610   350.5313 1048.5721 1048.5665 5.29 1 19 0.028 +1Score > 20 indicates identity
Score > 16 indicates homology
U M.SQSFSPLRK.F
2611   525.2957 1048.5768 1048.5665 9.84 1 25 0.0075 +1Score > 20 indicates identity
Score > 16 indicates homology
U M.SQSFSPLRK.F
2664 +1 1093.5425 1092.5352 1092.5339 1.21 0 51 6.6e-005 +1Score > 21 indicates identity U R.DVEVVYGEAL.-
2665 +1 547.2749 1092.5352 1092.5339 1.23 0 34 0.0006 +1Score > 21 indicates identity
Score > 15 indicates homology
U R.DVEVVYGEAL.-
2754   1191.7557 1190.7484 1190.7499 -1.23 1 42 6.4e-005 +1Score > 13 indicates identity U R.LVEHLIALKR.A
2756 +5 397.9243 1190.7511 1190.7499 0.99 1 53 5.2e-006 +1Score > 13 indicates identity U R.LVEHLIALKR.A
2760 +1 596.3843 1190.7540 1190.7499 3.49 1 68 1.5e-007 +1Score > 13 indicates identity U R.LVEHLIALKR.A
2866   426.8892 1277.6458 1277.6438 1.53 0 47 9.7e-005 +1Score > 23 indicates identity
Score > 20 indicates homology
U K.VIAEVFGIDCR.G
2867 +2 639.8305 1277.6464 1277.6438 2.06 0 82 6.5e-008 +1Score > 23 indicates identity U K.VIAEVFGIDCR.G
2956   704.8640 1407.7134 1407.7068 4.74 0 76 2.1e-007 +1Score > 22 indicates identity U R.VEEVMLGAEIYR.Q
2957   704.8643 1407.7140 1407.7068 5.16 0 87 2e-008 +1Score > 22 indicates identity U R.SILEFEGVDMIR.V
2966 +3 712.8572 1423.6998 1423.7017 -1.31 0 59 9.4e-006 +1Score > 22 indicates identity U R.SILEFEGVDMIR.V + Oxidation (M)
2969 +1 475.5752 1423.7038 1423.7017 1.45 0 47 0.00018 +1Score > 22 indicates identity U R.SILEFEGVDMIR.V + Oxidation (M)
2975 +11 712.8618 1423.7090 1423.7017 5.17 0 88 1.3e-008 +1Score > 22 indicates identity U R.VEEVMLGAEIYR.Q + Oxidation (M)
2978 +1 475.5772 1423.7098 1423.7017 5.68 0 64 3e-006 +1Score > 22 indicates identity U R.VEEVMLGAEIYR.Q + Oxidation (M)
3013   362.9425 1447.7409 1447.7320 6.13 1 53 1.5e-005 +1Score > 23 indicates identity
Score > 17 indicates homology
U R.HNVANYAKTFGAR.K
3014   483.5878 1447.7416 1447.7320 6.59 1 74 4.4e-007 +1Score > 23 indicates identity U R.HNVANYAKTFGAR.K
3020 +2 726.8718 1451.7290 1451.7231 4.08 0 73 4.9e-007 +1Score > 22 indicates identity U K.FVSPEIIFGAGCR.H
3021 +1 484.9174 1451.7304 1451.7231 4.99 0 52 3.2e-005 +1Score > 22 indicates identity
Score > 19 indicates homology
U K.FVSPEIIFGAGCR.H
3099 +1 753.9128 1505.8110 1505.8103 0.49 0 71 7.3e-007 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3101 +6 377.4608 1505.8141 1505.8103 2.52 0 51 7.2e-005 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3103 +4 502.9455 1505.8147 1505.8103 2.90 0 64 3.5e-006 +1Score > 22 indicates identity U R.AIGFHETLGLHGVR.T
3170 +2 518.6129 1552.8169 1552.8072 6.24 1 51 2.7e-005 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.FKVIAEVFGIDCR.G
3171 +1 777.4164 1552.8182 1552.8072 7.12 1 92 5.5e-009 +1Score > 22 indicates identity U R.FKVIAEVFGIDCR.G
3197   790.9182 1579.8218 1579.8181 2.38 1 73 5.3e-007 +1Score > 22 indicates identity U R.KFVSPEIIFGAGCR.H
3198 +1 527.6147 1579.8223 1579.8181 2.65 1 57 2e-005 +1Score > 22 indicates identity U R.KFVSPEIIFGAGCR.H
3244   811.9084 1621.8022 1621.7948 4.62 1 55 1e-005 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.ASSQRDVEVVYGEAL.-
3265   416.4860 1661.9149 1661.9114 2.10 1 31 0.0027 +1Score > 21 indicates identity
Score > 18 indicates homology
U K.RAIGFHETLGLHGVR.T
3266   554.9803 1661.9191 1661.9114 4.61 1 42 0.00041 +1Score > 21 indicates identity U K.RAIGFHETLGLHGVR.T
3444 +2 689.7085 2066.1037 2066.1194 -7.60 0 49 8.5e-005 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E
3448   1034.5796 2067.1446 2067.1034 20.0 0 86 1.3e-008 +1Score > 20 indicates identity U R.LINGNLVEMIANPTDIALR.E + Deamidated (NQ)
3449 +1 690.0562 2067.1468 2067.1034 21.0 0 95 1.5e-009 +1Score > 20 indicates identity U R.LINGNLVEMIANPTDIALR.E + Deamidated (NQ)
3450   1035.0446 2068.0746 2068.0874 -6.16 0 16 0.054 +1Score > 23 indicates identity
Score > 16 indicates homology
U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ)
3451   1035.0680 2068.1214 2068.0874 16.5 0 91 5.6e-009 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + 2 Deamidated (NQ)
3458   695.0488 2082.1246 2082.1143 4.94 0 58 1e-005 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M)
3459 +2 695.3805 2083.1197 2083.0983 10.3 0 83 2.8e-008 +1Score > 21 indicates identity
Score > 20 indicates homology
U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); Deamidated (NQ)
3460   1042.5686 2083.1226 2083.0983 11.7 0 102 4.3e-010 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); Deamidated (NQ)
3463   1042.5704 2083.1262 2083.0983 13.4 0 114 3.1e-011 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); Deamidated (NQ)
3467 -1 1043.0575 2084.1004 2084.0823 8.71 0 111 5.3e-011 +1Score > 22 indicates identity
Score > 20 indicates homology
U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3470   1043.0657 2084.1168 2084.0823 16.6 0 (76) 2.1e-007 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3468 +2 695.7075 2084.1007 2084.0823 8.81 0 83 1.9e-008 +1Score > 22 indicates identity
Score > 18 indicates homology
U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3469   695.7128 2084.1166 2084.0823 16.4 0 51 5.9e-005 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3473   1043.0698 2084.1250 2084.0823 20.5 0 48 3.7e-005 +1Score > 21 indicates identity
Score > 16 indicates homology
U R.LINGNLVEMIANPTDIALR.E + Oxidation (M); 2 Deamidated (NQ)
3489 +1 1050.9526 2099.8906 2099.9187 -13.4 0 9 0.39 +1Score > 17 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A
3522   706.3068 2115.8986 2115.9136 -7.12 0 36 0.0008 +1Score > 18 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Oxidation (M)
3525 +1 706.6472 2116.9198 2116.8976 10.5 0 67 1e-006 +1Score > 19 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Oxidation (M); Deamidated (NQ)
3526   1059.4674 2116.9202 2116.8976 10.7 0 81 3.8e-008 +1Score > 19 indicates identity U R.QNHCDVIVAVGGGSPMDCGK.A + Oxidation (M); Deamidated (NQ)
3724   775.4194 2323.2364 2323.2569 -8.84 1 50 0.0001 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALREK.I
3725   775.7673 2324.2801 2324.2409 16.8 1 76 1.2e-007 +1Score > 21 indicates identity
Score > 19 indicates homology
U R.LINGNLVEMIANPTDIALREK.I + Deamidated (NQ)
3727   776.0934 2325.2584 2325.2249 14.4 1 83 3.7e-008 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALREK.I + 2 Deamidated (NQ)
3729   781.0931 2340.2575 2340.2358 9.24 1 70 7.7e-007 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); Deamidated (NQ)
3730   1171.1361 2340.2576 2340.2358 9.32 1 89 8.9e-009 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); Deamidated (NQ)
3731   586.0718 2340.2581 2340.2358 9.51 1 51 5.7e-005 +1Score > 21 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); Deamidated (NQ)
3734 +1 781.4208 2341.2406 2341.2198 8.85 1 77 1.7e-007 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); 2 Deamidated (NQ)
3735   1171.6307 2341.2468 2341.2198 11.5 1 77 1.6e-007 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); 2 Deamidated (NQ)
3736   586.3198 2341.2501 2341.2198 12.9 1 44 7e-005 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); 2 Deamidated (NQ)
3739   781.7550 2342.2432 2342.2039 16.8 1 53 4.3e-005 +1Score > 22 indicates identity U R.LINGNLVEMIANPTDIALREK.I + Oxidation (M); 3 Deamidated (NQ)
3877   843.7385 2528.1937 2528.1676 10.3 0 68 1.5e-006 +1Score > 22 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Deamidated (NQ)
3886 +1 849.0701 2544.1885 2544.1625 10.2 0 58 1.4e-005 +1Score > 21 indicates identity U R.TSDIPFLSQHAMDDPCILTNPR.A + Oxidation (M); Deamidated (NQ)
3887   637.0554 2544.1925 2544.1625 11.8 0 24 0.0069 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.TSDIPFLSQHAMDDPCILTNPR.A + Oxidation (M); Deamidated (NQ)
3889   849.4059 2545.1959 2545.1465 19.4 0 18 0.022 +1Score > 22 indicates identity
Score > 14 indicates homology
U R.TSDIPFLSQHAMDDPCILTNPR.A + Oxidation (M); 2 Deamidated (NQ)
4095   769.6310 3074.4949 3074.4849 3.26 1 5 0.48 +1Score > 22 indicates identity
Score > 15 indicates homology
U R.QNHCDVIVAVGGGSPMDCGKAIGIVVAHGR.S + Deamidated (NQ)
4147 +6 1093.9365 3278.7877 3278.7398 14.6 0 81 3.4e-008 +1Score > 19 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
4152 +6 820.7065 3278.7969 3278.7398 17.4 0 68 6.2e-007 +1Score > 19 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Deamidated (NQ)
4156   820.9588 3279.8061 3279.7238 25.1 0 7 0.82 +1Score > 18 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQER.M + 2 Deamidated (NQ)
4265   881.9123 3523.6201 3523.5728 13.4 1 32 0.0037 +1Score > 21 indicates identity U R.VEEVMLGAEIYRQNHCDVIVAVGGGSPMDCGK.A + 2 Oxidation (M); 2 Deamidated (NQ)
4266   889.4883 3553.9241 3553.8702 15.2 1 25 0.011 +1Score > 18 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQERMK.F + Oxidation (M); Deamidated (NQ)
4267   1185.6525 3553.9357 3553.8702 18.4 1 1 2.4 +1Score > 17 indicates identity U R.VPSPPLILIPTTAGTSADVSQFVIISNQQERMK.F + Oxidation (M); Deamidated (NQ)
4368 +1 1051.5527 4202.1817 4202.0882 22.3 0 92 3.7e-009 +1Score > 20 indicates identity U K.VLVVSDPGVIAAGWVADVEASLQAQGIDYCLYTAVSPNPR.V + 2 Deamidated (NQ)
4391   1083.5737 4330.2657 4330.1831 19.1 1 99 5.6e-010 +1Score > 19 indicates identity U R.KVLVVSDPGVIAAGWVADVEASLQAQGIDYCLYTAVSPNPR.V + 2 Deamidated (NQ)
4392   867.0638 4330.2826 4330.1831 23.0 1 83 1.9e-008 +1Score > 18 indicates identity U R.KVLVVSDPGVIAAGWVADVEASLQAQGIDYCLYTAVSPNPR.V + 2 Deamidated (NQ)
4393   1083.8270 4331.2789 4331.1671 25.8 1 70 4.8e-007 +1Score > 19 indicates identity U R.KVLVVSDPGVIAAGWVADVEASLQAQGIDYCLYTAVSPNPR.V + 3 Deamidated (NQ)
4441 +2 1172.3817 4685.4977 4685.4150 17.7 1 44 0.00012 +1Score > 17 indicates identity U R.SILEFEGVDMIRVPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Oxidation (M); 2 Deamidated (NQ)
4443   781.9260 4685.5123 4685.4150 20.8 1 4 1.1 +1Score > 17 indicates identity U R.SILEFEGVDMIRVPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Oxidation (M); 2 Deamidated (NQ)
4444   938.1104 4685.5156 4685.4150 21.5 1 4 1.2 +1Score > 17 indicates identity U R.SILEFEGVDMIRVPSPPLILIPTTAGTSADVSQFVIISNQQER.M + Oxidation (M); 2 Deamidated (NQ)
4556   997.5043 5978.9821 5978.9256 9.46 0 8 0.48 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Deamidated (NQ)
4561   1002.8449 6011.0257 6010.9154 18.4 0 21 0.026 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 2 Oxidation (M); 3 Deamidated (NQ)
4562   1002.8453 6011.0281 6010.9154 18.8 0 12 0.21 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 2 Oxidation (M); 3 Deamidated (NQ)
4563   1003.0064 6011.9947 6011.8994 15.9 0 0 3 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 2 Oxidation (M); 4 Deamidated (NQ)
4565   862.0080 6027.0051 6026.9104 15.7 0 31 0.002 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
4567   1005.5089 6027.0097 6026.9104 16.5 0 38 0.00045 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
4569 +3 1005.5131 6027.0349 6026.9104 20.7 0 26 0.0062 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
4572   1005.6754 6028.0087 6027.8944 19.0 0 12 0.15 +1Score > 17 indicates identity U K.IMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 4 Deamidated (NQ)
4616   898.4577 6282.1530 6282.0799 11.6 1 6 0.67 +1Score > 17 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); Deamidated (NQ)
4617   1048.3654 6284.1487 6284.0479 16.0 1 11 0.24 +1Score > 17 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
4618   898.7435 6284.1536 6284.0479 16.8 1 23 0.015 +1Score > 17 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 3 Deamidated (NQ)
4619   1048.5330 6285.1543 6285.0319 19.5 1 17 0.06 +1Score > 18 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 4 Deamidated (NQ)
4621   898.8882 6285.1665 6285.0319 21.4 1 31 0.0025 +1Score > 18 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 4 Deamidated (NQ)
4622   786.6545 6285.1778 6285.0319 23.2 1 4 1.2 +1Score > 18 indicates identity U R.EKIMLGSMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNAVLVEHVVAFNYSSAPER.F + 3 Oxidation (M); 4 Deamidated (NQ)

1 subset or intersection (1 subset protein in total)

Score Mass Subset of
Q88PQ6_PSEPK 28 0 1.1
description

+2

Accession Score Description
1 3FLAG_TEV_PP_2683 1692 Fusion_protein_N_term_3FLAGTEV_in_frame_with_PP_2683

+3

Accession Score Description
1 TRYP_PIG 212 Trypsin OS=Sus scrofa PE=1 SV=1

+4

Accession Score Description
1 Q88HN7_PSEPK 173 Chaperone-associated ATPase, putative OS=Pseudomonas putida (strain KT2440) GN=PP_3316 PE=4 SV=1

+5

Accession Score Description
1 Q88QY6_PSEPK 50 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_0348 PE=4 SV=1

+6

Accession Score Description
1 CH60_PSEPK 47 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1

+7

Accession Score Description
1 Q88FW8_PSEPK 42 Voltage-gated chloride channel family protein OS=Pseudomonas putida (strain KT2440) GN=PP_3959 PE=4 SV=1

+8

Accession Score Description
1 Q88H31_PSEPK 37 description

+9

Accession Score Description
1 Q88RB6_PSEPK 36 Fatty acid desaturase family protein OS=Pseudomonas putida (strain KT2440) GN=PP_0217 PE=4 SV=1

+10

Accession Score Description
1 Q88MB8_PSEPK 34 GTP pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=relA PE=3 SV=1
Page: 1 2 3 4 Next 

Not what you expected? Try the select summary.