MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer16
MS data file : Ofer16.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:12:20 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,508

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 24 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4283)

Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4189 566.2975 1695.8707 1695.8501 12.1 1 3 0.81 +1Score > 26 indicates identity
Score > 14 indicates homology		 AAKMLAEEFGTASNIK + Oxidation (M)
4280 761.0434 2280.1084 2280.0580 22.1 1 3 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 TVDLVQYGGDMQPTPTKEQR + Oxidation (M); 2 Deamidated (NQ)
4370 846.4306 3381.6933 3381.6464 13.9 0 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 HLLEEPSPSLIDGYLAVLSSQPDDTSVDLDR + Deamidated (NQ)
4164 501.9429 1502.8069 1502.7576 32.8 1 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 GTEQEAKALEQATK
4349 958.1996 2871.5770 2871.6183 -14.4 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 ILIEPSVFNMSILLPPSLSFIQRLK + Oxidation (M); Deamidated (NQ)
4365 1081.5535 3241.6387 3241.6825 -13.5 1 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 ALIIDPECDIAVGTMAQLLLQQGKVSQALK + Oxidation (M); 3 Deamidated (NQ)
4451 964.8034 6746.5729 6746.4119 23.9 1 2 2 +1Score > 18 indicates identity RPITALDGNQANWGNHNFVPLLTDSSWSVPLLDEGMVVTIEPGIYFNRLALLNAQNQPLAK + Oxidation (M); 3 Deamidated (NQ)
4395 1016.7770 4063.0789 4063.0268 12.8 0 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 AMGNQILSHLIKPENANRPVHFFASSGGNAGLAAVCAAR + Oxidation (M); Deamidated (NQ)
4224 603.9728 1808.8966 1808.8978 -0.69 0 2 0.72 +1Score > 27 indicates identity
Score > 13 indicates homology		 SESVQAMVIATIEAFGR + Deamidated (NQ)
4152 730.3815 1458.7484 1458.7977 -33.7 1 2 0.86 +1Score > 27 indicates identity
Score > 14 indicates homology		 NSILGLGGGLMGRAK + Oxidation (M)
4366 1085.8960 3254.6662 3254.6255 12.5 1 2 0.92 +1Score > 25 indicates identity
Score > 14 indicates homology		 GGGNGAAHSIYMVGGLDLQFREHLLASQLAR + Oxidation (M); Deamidated (NQ)
4348 718.3796 2869.4893 2869.5801 -31.6 1 2 1 +1Score > 25 indicates identity
Score > 15 indicates homology		 IKPGDTLIEPTSGNTGIGLALVGAVKGYK + Deamidated (NQ)
4040 1030.5327 1029.5254 1029.5243 1.07 1 2 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 GAPTNWEKK
3959 828.3771 827.3698 827.4038 -41.1 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QPANWGR
4234 934.5586 1867.1026 1867.0277 40.1 0 2 2.1 +1Score > 18 indicates identity LLAQVALFMILTEAYR + Oxidation (M)
4122 426.2379 1275.6919 1275.6360 43.8 0 2 0.88 +1Score > 26 indicates identity
Score > 14 indicates homology		 FLHTSGTPNFR
3927 371.1719 740.3292 740.3275 2.30 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QAMYGR + Oxidation (M)
4334 688.6363 2750.5161 2750.4425 26.8 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LPANRPMLTELQIPAVHSSLLDYR + Oxidation (M); Deamidated (NQ)
4307 823.1246 2466.3520 2466.2615 36.7 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 QSTDEAVINAGLFNRTGPVAHLR + Deamidated (NQ)
4041 1031.5349 1030.5276 1030.5196 7.78 0 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 GVIPNDGFGR
4259 695.9664 2084.8774 2084.8945 -8.19 0 2 0.95 +1Score > 23 indicates identity
Score > 14 indicates homology		 WFYAHTYYSQEEFWK + Deamidated (NQ)
3796 509.2406 508.2333 508.2315 3.52 0 1 2.4 +1Score > 18 indicates identity MGTGK + Oxidation (M)
4310 832.4248 2494.2526 2494.2890 -14.6 1 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 LSSRLYIFQHATSLGNVESLMK + Deamidated (NQ)
4501 998.7350 8979.5495 8979.9370 -43.1 1 1 1.4 +1Score > 15 indicates identity SAMNNQGMPNGGLINPGVMPNQTDLVPLPDGQGMYPMNGDYYPPNGQMAQVRAGLQTPGGQHGNHALQDYQMQLMLLEQQNK + 6 Oxidation (M); 9 Deamidated (NQ)
4392 1016.5248 4062.0701 4061.9464 30.4 0 1 0.76 +1Score > 24 indicates identity
Score > 13 indicates homology		 FGLNAEQLGLQFLGLIIGSLLGEQLGGFMSDMWMNAR + 2 Oxidation (M); 4 Deamidated (NQ)
4362 774.3719 3093.4585 3093.5757 -37.9 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 IESLQSPQEILDNLREQYLQALYISK + 3 Deamidated (NQ)
4472 796.3019 7157.6516 7157.6464 0.73 1 1 3.6 +1Score > 19 indicates identity LAEYNISVNDVAPAMIGETGMIPSAAAIPEVAAGIPLGRLGLPDEVANVVTMLVTTGYMTGQSLLLGGGLK + 3 Oxidation (M); 3 Deamidated (NQ)
4426 1140.5592 5697.7596 5697.5590 35.2 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 YMAYGNGGFTGQVAFADMAPGLNYGFAVVSTNTGHNSSVQEAGDAGWALNNPETR + Oxidation (M)
4345 950.8707 2849.5903 2849.5069 29.2 1 1 0.83 +1Score > 22 indicates identity
Score > 13 indicates homology		 SGMIPGPRTLANAPEITTTGGAIVPGISR + Oxidation (M)
4352 993.1695 2976.4867 2976.4671 6.57 1 1 0.81 +1Score > 26 indicates identity
Score > 13 indicates homology		 VLAEVSEGLGEAMVGINVSQMAESDKLAK + 2 Deamidated (NQ)
4195 860.3992 1718.7838 1718.8588 -43.6 0 1 0.85 +1Score > 26 indicates identity
Score > 13 indicates homology		 NLPNGFTATATTQVAGR + Deamidated (NQ)
4297 793.4215 2377.2427 2377.2352 3.15 1 1 0.93 +1Score > 25 indicates identity
Score > 13 indicates homology		 VVFTTSCKYSLLDYSVAVIGR
4052 537.2872 1072.5598 1072.5665 -6.24 0 1 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 TPPPTPQHAK
4446 718.6283 6458.5892 6458.3795 32.5 1 1 2.2 +1Score > 17 indicates identity IGSLVHGPVPWLLSNALSHLDSACLAAATQLNLQDIIVDGPSPTSLDTIVAATGVSEDLLRR + Deamidated (NQ)
4016 322.5122 964.5148 964.5454 -31.8 1 1 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 RVTISSFR
4269 726.3997 2176.1773 2176.0695 49.5 1 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 IANGRVTIQGNADPGMLYGGR + Oxidation (M); Deamidated (NQ)
4256 1030.0280 2058.0414 2058.0480 -3.19 1 1 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 ATQRQQIILAAQLEEDTK + 3 Deamidated (NQ)
4455 706.6970 7056.8972 7057.0020 -14.8 0 1 2.7 +1Score > 18 indicates identity NQAESLLTNFGCDDTSIPEFGVGNCQDWVAGAIQMLENAGFVPPGEGQFWEEMINLSAAAMQDR + Oxidation (M); 9 Deamidated (NQ)
4296 791.3959 2371.1659 2371.1267 16.5 1 1 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 MTVNVPANPVEDRSPWWTQK + Oxidation (M); Deamidated (NQ)
4109 620.7972 1239.5798 1239.5852 -4.33 1 1 0.88 +1Score > 26 indicates identity
Score > 13 indicates homology		 HAPPQMQKMR + Oxidation (M); Deamidated (NQ)
4286 765.4211 2293.2415 2293.2066 15.2 1 1 0.97 +1Score > 24 indicates identity
Score > 13 indicates homology		 QIPTALPNRLYSIPDGEPGVR + Deamidated (NQ)
4505 1148.2139 9177.6530 9177.2176 47.4 1 1 2.1 +1Score > 16 indicates identity EYSLTGLKPDAKTVMYGFSGGAYATEWASELHSTYAPDLTQIVGAAMGGPPPNVTDTYLGCNMGPWAELNVWAMLGVMNAVPEMK + 5 Oxidation (M); 2 Deamidated (NQ)
4354 996.8369 2987.4889 2987.5763 -29.3 1 1 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 VSAIAVGIQQAGALAGCLAIWPVTNRHGR + 2 Deamidated (NQ)
4293 1165.0366 2328.0586 2328.1420 -35.8 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 DVDELQSFIKEHQVQPMLR + Oxidation (M); Deamidated (NQ)
4404 1144.0492 4572.1677 4572.2857 -25.8 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 QMTFAIMGFVAFYSLLSILIFTLGCNPVQAMWDVTIKDAK + 2 Oxidation (M); Deamidated (NQ)
4249 1012.5244 2023.0342 2023.0123 10.8 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 TSTNIWSRSFDNILGGVR + Deamidated (NQ)
4373 1147.9652 3440.8738 3440.8225 14.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 TATSTMVKNIQNPGAAQLAAVDDFLILAGGVPIK + Oxidation (M); Deamidated (NQ)
4151 727.8636 1453.7126 1453.7024 7.05 0 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 CRPVFQFASDVK + Deamidated (NQ)
4383 1013.0228 4048.0621 4047.8843 43.9 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 MPNLHLANTNQCYWSLLDGNGTATWRDAELTDAGVK + Oxidation (M)
4292 777.0258 2328.0556 2328.1557 -43.0 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 LVQVSSNATDASIRIHNTNTGK + 3 Deamidated (NQ)
4207 582.9446 1745.8120 1745.8263 -8.19 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 KVGLELCMSCNVHAK + Deamidated (NQ)
4315 837.0418 2508.1036 2508.2274 -49.4 0 0 1 +1Score > 25 indicates identity
Score > 13 indicates homology		 MVCVPSSSSVMELANLISQSIPK + 2 Oxidation (M)
4288 765.4234 2293.2484 2293.1597 38.7 0 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 HSVGLMQSTDNLLGVPRPNSR + Oxidation (M)
4413 1118.3422 5586.6746 5586.6666 1.44 1 0 0.98 +1Score > 22 indicates identity
Score > 13 indicates homology		 QSTFYLAGGIAILGMIVYWFLPESSELNLEEEDRDLSVFLAENGFPMEK + Oxidation (M); 3 Deamidated (NQ)
4102 612.7774 1223.5402 1223.5791 -31.7 0 0 0.98 +1Score > 25 indicates identity
Score > 13 indicates homology		 QALWSVMSMR + Oxidation (M)
4385 1013.0238 4048.0661 4047.8843 44.9 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 MPNLHLANTNQCYWSLLDGNGTATWRDAELTDAGVK + Oxidation (M)
3982 435.7773 869.5400 869.5586 -21.3 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 VVNLLIAK + Deamidated (NQ)
4060 361.8437 1082.5093 1082.4702 36.1 0 0 1 +1Score > 25 indicates identity
Score > 13 indicates homology		 SGAWMTASQK + Oxidation (M); Deamidated (NQ)
3966 848.4485 847.4412 847.4803 -46.2 0 0 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 GVYATPLK
3993 894.4828 893.4755 893.5157 -44.9 1 0 0.99 +1Score > 26 indicates identity
Score > 13 indicates homology		 KLMLAFR + Oxidation (M)
4329 907.4214 2719.2424 2719.2768 -12.6 1 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 LDQAMESYEVELNGTMHPVKCIR
4055 359.8792 1076.6158 1076.5767 36.3 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 SFTHAIFVR
1 300.1519 299.1446
2 300.1519 299.1446
3 300.1819 299.1746
4 300.1824 299.1751
5 300.1827 299.1754
6 300.2561 299.2488
7 301.0378 300.0305
8 301.0389 300.0316
9 301.0749 300.0676
10 301.0878 300.0805
11 301.1060 300.0987
12 301.1060 300.0987
13 301.1061 300.0988
14 301.1067 300.0994
15 301.1068 300.0995
16 301.1253 300.1180
17 301.1275 300.1202
18 301.1283 300.1210
19 301.1292 300.1219
20 301.1293 300.1220
21 301.1296 300.1223
22 301.1296 300.1223
23 301.1436 300.1363
24 301.1442 300.1369
25 301.1442 300.1369
26 301.1446 300.1373
27 301.1449 300.1376
28 301.1639 300.1566
29 301.1640 300.1567
30 301.1650 300.1577
31 301.1651 300.1578
32 301.1659 300.1586
33 301.2224 300.2151
34 301.9113 300.9040
35 301.9116 300.9043
36 302.1977 301.1904
37 302.1978 301.1905
38 302.1979 301.1906
Page: Previous 1 2 3 4 5 6 7 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/