MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer16
MS data file : Ofer16.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:12:20 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,508

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 24 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4283)

Page: 1 2 3 4 5 6 … 43 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3904 672.4077 671.4004 671.3966 5.69 0 23 0.13 +1Score > 27 indicates identity LSSIPR
3950 408.7065 815.3984 815.4137 -18.7 0 21 0.19 +1Score > 26 indicates identity ATPVSGER
3920 351.6951 701.3756 701.3959 -28.9 0 20 0.38 +1Score > 29 indicates identity LIDDVK
3980 435.7593 869.5040 869.4607 49.9 0 20 0.13 +1Score > 24 indicates identity VNSPSIPR + Deamidated (NQ)
3930 374.1873 746.3600 746.3559 5.62 0 19 0.46 +1Score > 28 indicates identity ISQENR + Deamidated (NQ)
3869 578.2963 577.2890 577.2894 -0.60 0 19 0.19 +1Score > 24 indicates identity MLGNK + Oxidation (M)
3934 392.7522 783.4898 783.4603 37.7 0 19 0.098 +1Score > 21 indicates identity VALPGATR
3942 401.7398 801.4650 801.4960 -38.6 1 18 0.44 +1Score > 27 indicates identity KLQATLK + Deamidated (NQ)
3921 702.3932 701.3859 701.3708 21.6 0 18 0.66 +1Score > 29 indicates identity IDNALR + Deamidated (NQ)
3888 637.3237 636.3164 636.2901 41.3 0 18 0.41 +1Score > 26 indicates identity MQTGGK + Oxidation (M)
3913 685.4277 684.4204 684.3918 41.8 1 17 0.21 +1Score > 23 indicates identity KNLGPR + Deamidated (NQ)
3978 434.7346 867.4546 867.4450 11.1 1 17 0.23 +1Score > 25 indicates identity
Score > 23 indicates homology		 YVDTRSK
3933 784.4962 783.4889 783.5218 -42.0 1 17 0.15 +1Score > 21 indicates identity LSKLVPK
3817 515.3331 514.3258 514.3227 6.03 0 17 0.55 +1Score > 27 indicates identity LGAVR
3891 644.3202 643.3129 643.2925 31.7 0 16 0.22 +1Score > 22 indicates identity ADPDAR
4043 517.2657 1032.5168 1032.5161 0.70 0 16 0.07 +1Score > 28 indicates identity
Score > 17 indicates homology		 DVIEIAMDK
3906 339.7025 677.3904 677.3860 6.50 0 16 0.13 +1Score > 25 indicates identity
Score > 20 indicates homology		 YVQLR
4000 456.7519 911.4892 911.5262 -40.6 0 16 0.46 +1Score > 25 indicates identity VTHMAILK
4092 1186.5979 1185.5906 1185.6353 -37.7 0 14 0.78 +1Score > 27 indicates identity
Score > 26 indicates homology		 DAGAISGLNVLR + Deamidated (NQ)
3981 435.7763 869.5380 869.5334 5.33 0 13 0.17 +1Score > 22 indicates identity
Score > 18 indicates homology		 VALNILAR + Deamidated (NQ)
3928 743.4446 742.4373 742.4337 4.84 0 13 0.63 +1Score > 26 indicates identity
Score > 23 indicates homology		 ALVTSPR
3867 571.3594 570.3521 570.3489 5.59 0 13 0.27 +1Score > 20 indicates identity IVSPR
4047 523.2928 1044.5710 1044.5604 10.2 0 12 0.21 +1Score > 27 indicates identity
Score > 18 indicates homology		 FLVQNLGPR + 2 Deamidated (NQ)
3976 432.7031 863.3916 863.4137 -25.6 0 12 0.96 +1Score > 26 indicates identity
Score > 24 indicates homology		 EFNEAVR
3922 717.4537 716.4464 716.4181 39.6 0 12 0.33 +1Score > 23 indicates identity
Score > 20 indicates homology		 LSALTGR
4140 464.5602 1390.6588 1390.6477 7.95 0 12 1 +1Score > 27 indicates identity
Score > 24 indicates homology		 ETGGTYDVGHSIR
4127 429.2267 1284.6583 1284.6350 18.1 0 11 0.89 +1Score > 27 indicates identity
Score > 23 indicates homology		 VSPHEYIPTNK + Deamidated (NQ)
4302 806.4433 2416.3081 2416.2333 30.9 0 11 0.17 +1Score > 24 indicates identity
Score > 16 indicates homology		 SLQATSAISVVAQAVVPDESTDTK
3890 322.6633 643.3120 643.3401 -43.7 1 11 0.4 +1Score > 22 indicates identity
Score > 19 indicates homology		 PSRQR + Deamidated (NQ)
4337 922.1358 2763.3856 2763.3003 30.9 0 11 0.21 +1Score > 27 indicates identity
Score > 16 indicates homology		 VFQDWQISDDSMIFWLHGIPGAGK + Oxidation (M); Deamidated (NQ)
4034 509.7652 1017.5158 1017.4978 17.7 0 10 0.4 +1Score > 28 indicates identity
Score > 19 indicates homology		 TIANDNEIK + Deamidated (NQ)
4299 797.4308 2389.2706 2389.1795 38.1 1 10 0.69 +1Score > 25 indicates identity
Score > 21 indicates homology		 QIDEQTGIIELQSRQNEMIK + Oxidation (M); Deamidated (NQ)
4294 785.0679 2352.1819 2352.2745 -39.4 0 10 0.99 +1Score > 27 indicates identity
Score > 22 indicates homology		 MFVLALIHTFPFIVFNIWK + Oxidation (M); Deamidated (NQ)
4059 541.2971 1080.5796 1080.6080 -26.2 0 10 0.25 +1Score > 25 indicates identity
Score > 16 indicates homology		 FGPGIIAAAHK
4221 903.9468 1805.8790 1805.9312 -28.9 1 9 0.45 +1Score > 27 indicates identity
Score > 18 indicates homology		 HVIKELVDTEYTFGR
4075 561.3125 1120.6104 1120.5659 39.8 1 9 0.57 +1Score > 25 indicates identity
Score > 19 indicates homology		 GVTMISARNR + Oxidation (M); Deamidated (NQ)
3935 392.7524 783.4902 783.4603 38.2 0 9 0.43 +1Score > 21 indicates identity
Score > 18 indicates homology		 VALPGATR
3893 324.1913 646.3680 646.3398 43.7 0 9 0.74 +1Score > 26 indicates identity
Score > 20 indicates homology		 AVTNSR
3911 342.6844 683.3542 683.3463 11.6 1 9 0.42 +1Score > 23 indicates identity
Score > 18 indicates homology		 HSRER
4093 593.8040 1185.5934 1185.6142 -17.5 1 9 0.32 +1Score > 27 indicates identity
Score > 17 indicates homology		 WSPDIAVDRK
3957 412.7555 823.4964 823.5028 -7.72 0 9 0.57 +1Score > 19 indicates identity RPSVLPR
3880 302.1785 602.3424 602.3275 24.8 0 9 0.87 +1Score > 28 indicates identity
Score > 21 indicates homology		 VDELK
3936 784.5177 783.5104 783.4715 49.6 0 9 0.36 +1Score > 20 indicates identity
Score > 17 indicates homology		 RPGTVVR
4051 537.2850 1072.5554 1072.5764 -19.5 0 9 0.75 +1Score > 28 indicates identity
Score > 20 indicates homology		 SLSPSNLQVK + Deamidated (NQ)
4097 607.8272 1213.6398 1213.6779 -31.3 1 9 0.69 +1Score > 26 indicates identity
Score > 20 indicates homology		 TIQGLNEKGVR
4111 415.2616 1242.7630 1242.7084 43.9 1 9 0.52 +1Score > 19 indicates identity VNRVWQSLLK + Deamidated (NQ)
3914 688.3925 687.3852 687.3625 33.0 0 9 0.65 +1Score > 29 indicates identity
Score > 19 indicates homology		 QAPLMK + Deamidated (NQ)
3949 816.4052 815.3979 815.4137 -19.4 0 9 0.35 +1Score > 25 indicates identity
Score > 17 indicates homology		 ATPVSGER
3956 823.4572 822.4499 822.4348 18.4 0 8 0.44 +1Score > 24 indicates identity
Score > 17 indicates homology		 VDHISPR
4037 511.2569 1020.4992 1020.5240 -24.2 0 8 0.4 +1Score > 28 indicates identity
Score > 17 indicates homology		 ITAFLGNQR + 2 Deamidated (NQ)
3941 401.2480 800.4814 800.4643 21.4 0 8 0.18 +1Score > 26 indicates identity
Score > 13 indicates homology		 AEEVLLK
3929 743.4449 742.4376 742.4337 5.24 0 8 0.38 +1Score > 26 indicates identity
Score > 16 indicates homology		 TGLSIPR
3970 428.7682 855.5218 855.5178 4.76 0 8 0.19 +1Score > 23 indicates identity
Score > 13 indicates homology		 IAANLQVK
4024 493.2733 984.5320 984.5716 -40.2 1 8 0.46 +1Score > 26 indicates identity
Score > 17 indicates homology		 LNDQVKIR
4229 930.9449 1859.8752 1859.9298 -29.3 1 8 0.68 +1Score > 27 indicates identity
Score > 18 indicates homology		 EAQLLEQNVMAKVNQK + Oxidation (M); 2 Deamidated (NQ)
4004 464.7852 927.5558 927.5614 -5.95 1 7 0.4 +1Score > 24 indicates identity
Score > 16 indicates homology		 LLANVRSR
4268 725.3698 2173.0876 2173.0296 26.7 0 7 0.33 +1Score > 27 indicates identity
Score > 15 indicates homology		 EICDELFHLQLDMNQLR
4148 477.9311 1430.7715 1430.8021 -21.4 1 7 0.45 +1Score > 26 indicates identity
Score > 16 indicates homology		 VEGIDFDLVLLKA
4336 922.1309 2763.3709 2763.3003 25.5 0 7 0.36 +1Score > 27 indicates identity
Score > 15 indicates homology		 VFQDWQISDDSMIFWLHGIPGAGK + Oxidation (M); Deamidated (NQ)
4216 897.9154 1793.8162 1793.8838 -37.6 1 7 0.62 +1Score > 27 indicates identity
Score > 17 indicates homology		 DMILRCLIQMIQAR + 2 Oxidation (M); 2 Deamidated (NQ)
3931 379.7311 757.4476 757.4446 4.01 1 6 1 +1Score > 26 indicates identity
Score > 19 indicates homology		 IERNVK
4192 856.4339 1710.8532 1710.9152 -36.2 0 6 0.89 +1Score > 27 indicates identity
Score > 18 indicates homology		 GNAETLGIPAQILSGIR + 2 Deamidated (NQ)
3997 302.5168 904.5286 904.5130 17.2 0 6 1 -1Score > 23 indicates identity
Score > 19 indicates homology		 AQGLFTLR
4340 926.4415 2776.3027 2776.2788 8.61 1 6 0.59 +1Score > 26 indicates identity
Score > 16 indicates homology		 RFVHNNSASSSQVPSSTSTPTPSGDVK + 3 Deamidated (NQ)
3903 670.3274 669.3201 669.3235 -4.98 0 6 0.93 +1Score > 22 indicates identity
Score > 18 indicates homology		 YFQGR
3915 345.2151 688.4156 688.4119 5.41 0 6 0.91 +1Score > 25 indicates identity
Score > 18 indicates homology		 QLLSTK
4423 631.3708 5673.2717 5673.5419 -47.6 1 6 0.59 +1Score > 16 indicates identity HESELAMYLENQRYLGCTNTPMMTGYQFQDEDLVSLDQTTIALQNVQK + 3 Oxidation (M); 3 Deamidated (NQ)
4312 835.7907 2504.3503 2504.2798 28.1 1 6 0.71 +1Score > 24 indicates identity
Score > 17 indicates homology		 LALLNAQNQPLAKYINFDEAEK + 2 Deamidated (NQ)
4108 414.2001 1239.5785 1239.6207 -34.1 1 6 0.83 +1Score > 26 indicates identity
Score > 17 indicates homology		 SVQRSYASVSR + Deamidated (NQ)
4042 1032.5560 1031.5487 1031.5247 23.3 0 6 1 +1Score > 28 indicates identity
Score > 18 indicates homology		 QNSGVLTQGK + Deamidated (NQ)
4402 718.0232 4302.0955 4302.0759 4.57 1 5 0.37 +1Score > 24 indicates identity
Score > 14 indicates homology		 GLTYDQLKQTGCMLCLNNTYHLGLKPGQAVLDEVGGAHK + 3 Deamidated (NQ)
3937 787.4300 786.4227 786.4096 16.6 1 5 0.52 +1Score > 28 indicates identity
Score > 15 indicates homology		 QNGGGRAK
3910 683.3283 682.3210 682.3221 -1.53 1 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology		 CGYKR
3962 842.5134 841.5061 841.4657 48.0 1 5 0.35 +1Score > 24 indicates identity
Score > 13 indicates homology		 KHSTLQK + Deamidated (NQ)
4378 920.2012 3676.7757 3676.8175 -11.4 0 5 1 +1Score > 26 indicates identity
Score > 17 indicates homology		 MATATQQPETSGLQNISALLETITGCLTAAGSSLPK + Oxidation (M); Deamidated (NQ)
4317 842.4334 2524.2784 2524.2135 25.7 0 5 0.78 +1Score > 27 indicates identity
Score > 16 indicates homology		 HLYHSLYSHSINPDIEFNPNK
4406 691.2188 4831.4807 4831.2575 46.2 1 5 1 +1Score > 22 indicates identity
Score > 17 indicates homology		 AAQAVQAVQAAQPVQPVQAQAAQPAICACVQNNTCPCKGTFSFSR + 3 Deamidated (NQ)
4276 742.7168 2225.1286 2225.1436 -6.75 0 5 0.66 +1Score > 27 indicates identity
Score > 15 indicates homology		 TMSTAISVVIGGVVFQNQMVK + Oxidation (M); Deamidated (NQ)
3898 329.7047 657.3948 657.4173 -34.2 1 5 0.92 +1Score > 27 indicates identity
Score > 17 indicates homology		 NGIKVK
3882 304.1771 606.3396 606.3125 44.7 0 5 0.73 +1Score > 25 indicates identity
Score > 16 indicates homology		 LNGFR + Deamidated (NQ)
4357 1010.5594 3028.6564 3028.6897 -11.0 1 4 0.41 +1Score > 22 indicates identity
Score > 13 indicates homology		 KPFIMFLLAVFGLPYLMSKLIQSLAR + 2 Oxidation (M); Deamidated (NQ)
4303 808.0370 2421.0892 2421.1482 -24.4 0 4 1 +1Score > 26 indicates identity
Score > 17 indicates homology		 NPSFAASSTSNSPLSPEMIASLGR + Deamidated (NQ)
4257 687.3563 2059.0471 2059.0004 22.7 1 4 0.82 +1Score > 27 indicates identity
Score > 15 indicates homology		 CASPRLVSNAQIQEETQK + Deamidated (NQ)
4065 369.1920 1104.5542 1104.5662 -10.9 0 4 0.84 +1Score > 27 indicates identity
Score > 16 indicates homology		 LISSNSVEEK
4335 918.1808 2751.5206 2751.5033 6.27 1 4 0.54 +1Score > 22 indicates identity
Score > 13 indicates homology		 FSLGAIQQSLMIWQLFQILTAKSK + Deamidated (NQ)
4342 932.4448 2794.3126 2794.3304 -6.38 1 4 0.75 +1Score > 26 indicates identity
Score > 15 indicates homology		 VQGGINGSQSSRAMNDGGISYNISLPR + Oxidation (M); Deamidated (NQ)
4343 942.1265 2823.3577 2823.3899 -11.4 0 4 0.57 +1Score > 26 indicates identity
Score > 14 indicates homology		 NIQQVNGRPAPPPLATSGLNEPNGHSR + 3 Deamidated (NQ)
4319 854.4033 2560.1881 2560.2214 -13.0 0 4 0.84 +1Score > 26 indicates identity
Score > 15 indicates homology		 MAAAIDSTPPTALTAVQQPDSTETK + Oxidation (M); Deamidated (NQ)
4072 372.5424 1114.6054 1114.5632 37.8 1 3 0.84 +1Score > 27 indicates identity
Score > 15 indicates homology		 QDQVRWQR
4054 539.3148 1076.6150 1076.5767 35.6 0 3 1 +1Score > 23 indicates identity
Score > 16 indicates homology		 SFTHAIFVR
4073 558.3100 1114.6054 1114.5618 39.1 0 3 1 +1Score > 27 indicates identity
Score > 16 indicates homology		 AAAATAAADSPAK
4283 762.7177 2285.1313 2285.0997 13.8 1 3 0.83 +1Score > 27 indicates identity
Score > 15 indicates homology		 YSIEEATASISNKSLAWQMR + Deamidated (NQ)
4223 453.2313 1808.8961 1808.8978 -0.96 0 3 0.69 +1Score > 27 indicates identity
Score > 14 indicates homology		 SESVQAMVIATIEAFGR + Deamidated (NQ)
4062 545.2601 1088.5056 1088.5324 -24.6 1 3 0.82 +1Score > 26 indicates identity
Score > 15 indicates homology		 MKAYIQYR + Oxidation (M); Deamidated (NQ)
4233 467.7428 1866.9421 1866.9071 18.7 0 3 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 AIHAGAAQASESLDELER
4377 1167.2633 3498.7681 3498.9013 -38.1 1 3 0.57 +1Score > 25 indicates identity
Score > 13 indicates homology		 GAPNDLVSNFNPLTIIIASPILNYGLYPLLRK + 3 Deamidated (NQ)
4032 337.8474 1010.5204 1010.5107 9.61 0 3 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 EVFTMLQK + Oxidation (M)
4222 602.9679 1805.8819 1805.8326 27.3 1 3 0.97 +1Score > 27 indicates identity
Score > 15 indicates homology		 SQDGASLRAGGDALQGMR + Oxidation (M); Deamidated (NQ)
4356 1010.2235 3027.6487 3027.5355 37.4 0 3 0.87 +1Score > 22 indicates identity
Score > 15 indicates homology		 NQPHPLNFSALHLLHDPQGFAEALFSK
4265 712.3782 2134.1128 2134.0113 47.6 1 3 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 LNAPGAGNTVRGQEFSDMLR + 2 Deamidated (NQ)
Page: 1 2 3 4 5 6 … 43 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/