MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer6
MS data file : Ofer6.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:09:20 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,543

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 23 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 4375)

Page: Previous 1 2 3 4 5 6 7 8 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4153 910.7848 2729.3326 2729.2175 42.2 0 3 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 CPLWAMQSSLLNMIFESWSGDPK + 2 Oxidation (M); Deamidated (NQ)
4192 950.8704 2849.5894 2849.4845 36.8 1 3 0.82 +1Score > 22 indicates identity
Score > 14 indicates homology		 SKLVDLLQSLGHVVAMTGDGVNDAPALK + 2 Deamidated (NQ)
4293 869.9799 3475.8905 3475.8702 5.85 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 TFDYVIAGGGLTGLTVATKLTENPDIEVLVIEK
4115 851.0956 2550.2650 2550.2159 19.2 0 2 0.63 +1Score > 27 indicates identity
Score > 13 indicates homology		 AATDQPSGLMDIASSLTQDEIPFK + Oxidation (M)
3918 602.9673 1805.8801 1805.9047 -13.6 0 2 0.95 +1Score > 27 indicates identity
Score > 15 indicates homology		 YQNTILQNLDEDVIK + Deamidated (NQ)
4322 1013.0231 4048.0633 4048.0159 11.7 0 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 AMGNQILSHLIKPENANRPVHFFASSGGNAGLAAVCAAR + 2 Deamidated (NQ)
4220 976.1182 2925.3328 2925.3562 -8.02 1 2 0.67 +1Score > 26 indicates identity
Score > 13 indicates homology		 NHVQNAAKYSAQMHAINLSDPDTLQR + 4 Deamidated (NQ)
4449 817.2396 8978.5556 8978.8364 -31.3 1 2 1.2 +1Score > 16 indicates identity QEQLSQGQPQAQAQASQEPETDAQELQQTNPDHEPAPTPDSEPSDEEDDEDHPLPAAGTQQQQQQQPAWMRPSQSWLKTK + Oxidation (M); 12 Deamidated (NQ)
4474 1142.9644 9135.6570 9135.9872 -36.1 1 2 1.4 +1Score > 16 indicates identity RQSAASALLAQLLGNQSSMPSDGPGPSAEHSVPAAQDTNQPQDIDDGMNGQWSTDAPAGTTAMSSDPTGGQDQIPANSNELPESQQEQK + Oxidation (M); 7 Deamidated (NQ)
4001 728.0260 2181.0562 2181.0875 -14.4 1 2 0.74 +1Score > 27 indicates identity
Score > 14 indicates homology		 NESDLLFPMNETTVSIVKK + Oxidation (M); Deamidated (NQ)
4174 926.4400 2776.2982 2776.3589 -21.9 1 2 0.95 +1Score > 26 indicates identity
Score > 15 indicates homology		 IIQWLITLNQMRATEELSEDQAR + Oxidation (M); 3 Deamidated (NQ)
4277 834.4114 3333.6165 3333.5650 15.4 1 2 0.84 +1Score > 26 indicates identity
Score > 14 indicates homology		 IWITNTVENQPWQGATGQNGSATNPGSGRYK + 2 Deamidated (NQ)
3964 1008.5341 2015.0536 2015.0146 19.4 0 2 0.68 +1Score > 26 indicates identity
Score > 13 indicates homology		 IGIAAQMTGLALGAWENAAR + 2 Deamidated (NQ)
4361 1118.5399 5587.6631 5587.4766 33.4 1 2 0.81 +1Score > 22 indicates identity
Score > 14 indicates homology		 AASGITSFIQNNSVDSLPSLTEGMFGYSMTRSLHSENYHDGILDACEQFR + 2 Oxidation (M); 3 Deamidated (NQ)
4351 1150.5946 4598.3493 4598.4177 -14.9 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 MQIADMAASTTAQILVVSLGLLIFVLLCPWFGYLRLPSSMR + Oxidation (M); Deamidated (NQ)
3874 546.9887 1637.9443 1637.9075 22.4 1 2 0.68 +1Score > 21 indicates identity
Score > 13 indicates homology		 ALIAWQPIPVMRAR + Oxidation (M); Deamidated (NQ)
4102 839.7642 2516.2708 2516.1999 28.2 0 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 TMSMQSQAPPKPAGQPTLVASNSR + 2 Oxidation (M); Deamidated (NQ)
4503 1026.9667 9233.6348 9233.9210 -31.0 1 2 1 +1Score > 15 indicates identity TEPQIVPNTPSFIPPMAMHGDVVNPLALQDPQQWPNSLGNFDDMDLMATADYNNLSFDDPVSSPMFNRQIPMNCMSYMDAK + 6 Oxidation (M); 10 Deamidated (NQ)
4187 943.1438 2826.4096 2826.4704 -21.5 0 2 0.87 +1Score > 26 indicates identity
Score > 14 indicates homology		 HWGQTALEHLPPQAQDVLLHPLVPK + 3 Deamidated (NQ)
3713 846.4459 845.4386 845.4793 -48.1 0 2 0.83 +1Score > 29 indicates identity
Score > 14 indicates homology		 QVLMSLR
3759 322.5121 964.5145 964.5454 -32.1 1 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 RVTISSFR
4051 770.3952 2308.1638 2308.2521 -38.3 1 2 0.65 +1Score > 27 indicates identity
Score > 13 indicates homology		 NFTFWVKPPLWVNLHPVKS
3905 887.4531 1772.8916 1772.9057 -7.93 1 2 0.72 +1Score > 27 indicates identity
Score > 13 indicates homology		 VDFSGRTVISPDPNLR + Deamidated (NQ)
4288 849.6973 3394.7601 3394.8646 -30.8 1 2 0.9 +1Score > 25 indicates identity
Score > 14 indicates homology		 ISGGTSLDFALIGGLSASQALVISPLITMIHRR + Deamidated (NQ)
4045 765.4219 2293.2439 2293.2147 12.7 1 2 0.7 +1Score > 24 indicates identity
Score > 13 indicates homology		 AELPGQFYVWLASPEAKFLK
3952 977.5061 1952.9976 1952.9778 10.2 1 2 0.79 +1Score > 27 indicates identity
Score > 13 indicates homology		 GCPPVYKTPAAPNESPLR
4482 918.5735 9175.6622 9176.1079 -48.6 1 2 1.3 +1Score > 16 indicates identity SQEAGQLVVPASSSQMNQQPFTTPQNMFQVGQGNQTNMNGAGISPQFFSQQQLQTSQNLQQDRTQQAPQFQPQSQAQTQAQAR + 2 Oxidation (M); 11 Deamidated (NQ)
4152 910.4575 2728.3507 2728.2944 20.6 0 2 0.76 +1Score > 27 indicates identity
Score > 13 indicates homology		 LIMGIASSVPVTVGGGFVADMMPMER + 4 Oxidation (M)
3965 1012.5239 2023.0332 2022.9655 33.5 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 GHDAKFPGMAITYALMQR + Oxidation (M); Deamidated (NQ)
4107 632.5903 2526.3321 2526.3112 8.28 1 2 0.85 +1Score > 25 indicates identity
Score > 14 indicates homology		 AKQGQMVLTLGGDHSIAIGSISGSAK + Deamidated (NQ)
4271 1099.8658 3296.5756 3296.5727 0.87 0 2 0.97 +1Score > 26 indicates identity
Score > 14 indicates homology		 QSQLSMIAASASEMVPQGMPLDHDIVDGLPK + 2 Oxidation (M)
4181 931.4619 2791.3639 2791.2872 27.5 1 2 0.99 +1Score > 26 indicates identity
Score > 14 indicates homology		 VDVYIVPSEDSHQSEYIAPCDGRR
4498 918.8739 9178.6662 9178.4626 22.2 1 2 1.5 +1Score > 16 indicates identity WVGYQIIAGSSTGFISQIPIMANTACVEMQDMSTASAMTLFFQLIGGSFSVSAAQSVFGNVLFNRIQNTVPGLSPEAVIGAVAANLR + 3 Oxidation (M); 6 Deamidated (NQ)
4165 922.4676 2764.3810 2764.2539 46.0 1 2 0.84 +1Score > 27 indicates identity
Score > 13 indicates homology		 RPSGAMMLQPQRLMQEAPLDMNAK + 3 Oxidation (M); 4 Deamidated (NQ)
4056 770.4115 2308.2127 2308.1998 5.59 1 2 0.69 +1Score > 26 indicates identity
Score > 13 indicates homology		 GSYIFCQLIALGRAADPSTLR
3728 435.7769 869.5392 869.5698 -35.1 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 VIKQLLR + Deamidated (NQ)
4258 1066.2220 3195.6442 3195.5128 41.1 1 2 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 ALTENSEILTNIPSDYLNTEEDMAKLNR + 2 Deamidated (NQ)
4309 928.4891 3709.9273 3709.7628 44.3 1 2 0.93 +1Score > 24 indicates identity
Score > 14 indicates homology		 EIQLANSSQVIVIDSDVSGPPSPEGGMAAPKADEER + Oxidation (M); Deamidated (NQ)
4239 769.4368 3073.7181 3073.6434 24.3 1 2 0.91 +1Score > 20 indicates identity
Score > 14 indicates homology		 ILTEQVRQILDGNIQVNNTLSFTLLVK + 5 Deamidated (NQ)
4026 1131.0754 2260.1362 2260.0755 26.9 0 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 MDIHNLATVMAPNILYPNAK + 2 Oxidation (M); 3 Deamidated (NQ)
4122 869.1120 2604.3142 2604.2629 19.7 0 2 0.95 +1Score > 26 indicates identity
Score > 14 indicates homology		 MPVEPNSSAPASYSVSPVTLLDASGK + Deamidated (NQ)
4073 804.3895 2410.1467 2410.1209 10.7 0 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 SLQGLAPNVNIVNMYGTTETQR + 5 Deamidated (NQ)
4142 896.8068 2687.3986 2687.4244 -9.61 0 2 0.75 +1Score > 25 indicates identity
Score > 13 indicates homology		 EIADFGHILMVTTGIGIAAQLPYIK + Oxidation (M); Deamidated (NQ)
4083 821.7521 2462.2345 2462.1999 14.0 1 2 0.99 +1Score > 27 indicates identity
Score > 14 indicates homology		 KEPTDFMAITSLEQDEVPAVSR
4273 834.4099 3333.6105 3333.4855 37.5 1 2 0.97 +1Score > 26 indicates identity
Score > 14 indicates homology		 SNVIEEAGSSQQNDGPGATLESGQDGEKGVELK + 4 Deamidated (NQ)
4180 929.7992 2786.3758 2786.4174 -14.9 0 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 LTNQGQAVLATIHQPSAMLFQTFDR
4100 839.4131 2515.2175 2515.1683 19.6 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 TSSVGMEIMGFDSRGEIVTSAQGR + Deamidated (NQ)
3643 683.3289 682.3216 682.2922 43.1 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 YEESR
4072 803.4238 2407.2496 2407.2365 5.44 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 FLPSPFGSFLKAYSLWYQTR
4232 1008.5323 3022.5751 3022.4443 43.3 1 2 0.89 +1Score > 25 indicates identity
Score > 14 indicates homology		 MWINGGHHHIQMGFRLTPEPSHPQAK + Oxidation (M); Deamidated (NQ)
3791 1085.5642 1084.5569 1084.5876 -28.3 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 QEILPKSNR + Deamidated (NQ)
4013 736.7007 2207.0803 2207.1885 -49.0 1 1 0.77 +1Score > 27 indicates identity
Score > 13 indicates homology		 ILPEYHPLTMQVNRVLQR + Deamidated (NQ)
4300 1175.2891 3522.8455 3522.8239 6.12 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 AMQPVDILINAAGISNSNILPKTSPEEVSQTLR + Oxidation (M); Deamidated (NQ)
4067 794.0782 2379.2128 2379.2142 -0.61 0 1 0.81 +1Score > 26 indicates identity
Score > 13 indicates homology		 EVAGSAGLQAANDSASVVLSHQIR
4120 864.1141 2589.3205 2589.2632 22.1 0 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 IQPINGDPVAMDLTANESLALSFR + Oxidation (M); 2 Deamidated (NQ)
4147 902.8499 2705.5279 2705.5037 8.93 0 1 0.73 +1Score > 20 indicates identity
Score > 13 indicates homology		 LLLIEISSVICALPELQGVPGIESR
3978 701.7172 2102.1298 2102.0797 23.8 1 1 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 TTGQALGKGASWTWNTPVVK + Deamidated (NQ)
4312 961.7193 3842.8481 3842.7292 31.0 0 1 0.88 +1Score > 25 indicates identity
Score > 13 indicates homology		 TGIIMNNEMDDFSVPTSSLPTFGHTPSSTNFAEPGK + Oxidation (M); Deamidated (NQ)
3982 707.6887 2120.0443 2120.0055 18.3 1 1 0.97 +1Score > 27 indicates identity
Score > 14 indicates homology		 TVESTKSAASMQTPPPSSASR + Deamidated (NQ)
3805 593.8035 1185.5924 1185.5336 49.7 0 1 0.86 +1Score > 27 indicates identity
Score > 13 indicates homology		 VVEHMESDPK + Oxidation (M)
3999 727.4106 2179.2100 2179.1268 38.1 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VLVVDDNAINLNLMLTFMK + Oxidation (M); Deamidated (NQ)
4195 951.4553 2851.3441 2851.3918 -16.7 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 IADASIMPVIPDCRIQNSVYMIGEK + 2 Oxidation (M)
3547 531.3533 530.3460 530.3428 6.13 0 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 ISALK
4109 633.8040 2531.1869 2531.1526 13.6 0 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 AWFVQSEVTENLMAAAEDLYAR + Oxidation (M); 2 Deamidated (NQ)
4316 968.9866 3871.9173 3871.8323 22.0 1 1 0.77 +1Score > 25 indicates identity
Score > 13 indicates homology		 FQQIPDYSGDGMANPNDVTIEIPLNPVPSRGQTGAR + Oxidation (M); 2 Deamidated (NQ)
4458 1123.3315 8978.5938 8978.9021 -34.3 0 1 1.5 +1Score > 16 indicates identity QSAASALLAQLLGNQSSMPSDGPGPSAEHSVPAAQDTNQPQDIDDGMNGQWSTDAPAGTTAMSSDPTGGQDQIPANSNELPESQQEQK + Oxidation (M); 6 Deamidated (NQ)
4502 1026.9667 9233.6348 9233.3336 32.6 1 1 1.2 +1Score > 15 indicates identity FIAEGVSPQYMLPSFPSVTFPNHFTLVTGLYPESHGIVGNTFWDPELQEEFYYTHPSVSMRPKWWNAEPLWMAAENQGVK + 5 Deamidated (NQ)
4476 918.4666 9174.5932 9174.9665 -40.7 1 1 1.5 +1Score > 16 indicates identity MSTITTTTTTTTTAAAAAASSSCHAKLYEIPTTDAACAMPMNSTYHTLMTNCCGAASVISYSDCDYYCLAQNQTIGNLAECLIK + 6 Deamidated (NQ)
4168 924.1387 2769.3943 2769.4184 -8.73 1 1 0.87 +1Score > 27 indicates identity
Score > 13 indicates homology		 AAASGPYGGSEILEGIEGLEAPGKEVIR
4126 877.1255 2628.3547 2628.3304 9.22 0 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 VWCEMRPGLLGWNILNLSNIAR + Oxidation (M); Deamidated (NQ)
4418 895.7190 7157.6938 7157.4390 35.6 1 1 3.4 +1Score > 19 indicates identity QPTTLQHFFITLVAMSGFQGLTQYTPSMIKSFGFNAIQANALASVPIYCSMVWCLVLSYFADR + Oxidation (M); 5 Deamidated (NQ)
4310 942.4664 3765.8365 3765.6556 48.0 1 1 0.89 +1Score > 26 indicates identity
Score > 13 indicates homology		 NYEGMSGLSLAAGKGHNDIVEMLVEAGAEPNCEDR + 2 Oxidation (M); Deamidated (NQ)
4022 753.3841 2257.1305 2257.0247 46.9 0 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 SQHFSDNGNGTLVELNPNVGR + 3 Deamidated (NQ)
4086 823.1259 2466.3559 2466.2615 38.3 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 QSTDEAVINAGLFNRTGPVAHLR + Deamidated (NQ)
4138 892.4656 2674.3750 2674.2850 33.7 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 IVEISPDDVIWDNMSIRWWER + Oxidation (M)
4353 1166.0842 4660.3077 4660.2404 14.4 1 1 0.85 +1Score > 24 indicates identity
Score > 13 indicates homology		 VDHYSFMNVVAMLNNVMGCVVAFIPEGMPVGVALTLMMVAKR + 3 Oxidation (M); 2 Deamidated (NQ)
4446 998.5176 8977.5929 8977.9181 -36.2 0 1 1.7 +1Score > 16 indicates identity QSAASALLAQLLGNQSSMPSDGPGPSAEHSVPAAQDTNQPQDIDDGMNGQWSTDAPAGTTAMSSDPTGGQDQIPANSNELPESQQEQK + Oxidation (M); 5 Deamidated (NQ)
4039 765.0422 2292.1048 2292.0328 31.4 1 1 0.8 +1Score > 27 indicates identity
Score > 13 indicates homology		 QQYMIQESDNSLYGRSTVR + Oxidation (M); 2 Deamidated (NQ)
4093 832.0894 2493.2464 2493.3049 -23.5 1 1 0.82 +1Score > 27 indicates identity
Score > 13 indicates homology		 LSSRLYIFQHATSLGNVESLMK
4262 1079.5392 3235.5958 3235.6325 -11.3 0 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 RPMLLASSAVMAAGLLTMGGLGTPSPMTTDLK + 3 Oxidation (M)
3819 620.7967 1239.5788 1239.5852 -5.14 1 1 0.86 +1Score > 26 indicates identity
Score > 13 indicates homology		 HAPPQMQKMR + Oxidation (M); Deamidated (NQ)
4008 1102.5803 2203.1460 2203.1559 -4.45 0 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 TVPTVGQNVATINLPEMYLK + Oxidation (M)
4274 834.4103 3333.6121 3333.5380 22.2 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 AAQASEDLQKLDQAMESYEVELNGTMHPVK + 2 Deamidated (NQ)
3869 542.3125 1623.9157 1623.9070 5.36 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 RPRPRSINGPTAFR
4079 808.7691 2423.2855 2423.3206 -14.5 1 1 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 GEVMSLLVRPLQPSDLQVIRR + Oxidation (M); 2 Deamidated (NQ)
4218 975.7832 2924.3278 2924.4549 -43.5 1 1 0.98 +1Score > 26 indicates identity
Score > 13 indicates homology		 ARQQQMQAAIAVVKPSQAESVQEPPSK + Oxidation (M); 3 Deamidated (NQ)
4044 765.4211 2293.2415 2293.2405 0.42 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 MWLGSSFTNLKPVQAAKFLR
4500 1155.0881 9232.6466 9232.4485 21.5 1 1 1.4 +1Score > 15 indicates identity EIPASAAQSQPGQLDSTPSASQPLQSPQIASAPMMNTTQPQQAMLPHQTPMIPGQPGLQQAVAHPQPPVGQSPARTGPAVRPDLMHQR + 2 Oxidation (M); 6 Deamidated (NQ)
4136 885.4421 2653.3045 2653.2885 6.03 1 1 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 DRQPFGVLTPNPPLPEGHPGANGQR + 3 Deamidated (NQ)
4201 956.4915 2866.4527 2866.3409 39.0 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 AVPNIDGGSYLSFILQHAYRNDGNDK + 3 Deamidated (NQ)
4237 1020.5294 3058.5664 3058.4926 24.1 1 1 1 +1Score > 25 indicates identity
Score > 14 indicates homology		 KLDAGVMPSHGMFSQVANIGPMAELSLDK + Oxidation (M)
3678 783.4360 782.4287 782.4399 -14.2 0 1 0.87 +1Score > 23 indicates identity
Score > 13 indicates homology		 KPAPSGAR
4348 1089.0482 4352.1637 4352.1224 9.49 0 1 0.81 +1Score > 24 indicates identity
Score > 13 indicates homology		 QLSILDVTTAQSSGITSQFPYFSVDVLPPSNINDSELDPR + 2 Deamidated (NQ)
4092 832.0892 2493.2458 2493.3049 -23.7 1 1 0.98 +1Score > 27 indicates identity
Score > 13 indicates homology		 LSSRLYIFQHATSLGNVESLMK
4301 1175.2966 3522.8680 3522.7442 35.1 1 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 MGVNMCTMTPSSISTLKPEAVPSLRTIITGGEK + Oxidation (M); Deamidated (NQ)
3679 784.3647 783.3574 783.3585 -1.38 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LMDYAR + Oxidation (M)
4137 664.3343 2653.3081 2653.2218 32.5 0 1 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 TVYVEHDLDSADTEQTVIGWTMK + Oxidation (M)
4167 924.1365 2769.3877 2769.3016 31.1 1 1 0.91 +1Score > 27 indicates identity
Score > 13 indicates homology		 LMHANYSPPFQAPMHGQRRPFNR + Oxidation (M); 2 Deamidated (NQ)
4370 1026.4132 6152.4355 6152.2992 22.2 1 1 2.1 +1Score > 17 indicates identity SKVFRPFGLFLLALAYTVVHATALFYQVMTLNVAVNSYSNALLSLLLSNQFVEIK + Oxidation (M); 3 Deamidated (NQ)
4275 834.4108 3333.6141 3333.4855 38.6 1 1 0.98 +1Score > 26 indicates identity
Score > 13 indicates homology		 SNVIEEAGSSQQNDGPGATLESGQDGEKGVELK + 4 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/