MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer6
MS data file : Ofer6.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:09:20 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,543

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 23 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4375)

Page: 1 2 3 4 5 6 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3648 702.3934 701.3861 701.3708 21.9 0 24 0.18 -1Score > 29 indicates identity DLNAIR + Deamidated (NQ)
3689 400.2090 798.4034 798.3872 20.4 0 23 0.078 +1Score > 24 indicates identity DESHIAK
3697 408.7063 815.3980 815.4137 -19.2 0 20 0.17 +1Score > 25 indicates identity ATPVSGER
3636 672.4069 671.3996 671.4330 -49.7 0 20 0.24 +1Score > 27 indicates identity TAVIIR
3792 547.2725 1092.5304 1092.5234 6.49 0 20 0.26 +1Score > 27 indicates identity GSVANMSLGGGK + Oxidation (M)
3802 584.8075 1167.6004 1167.5924 6.89 0 20 0.074 +1Score > 26 indicates identity
Score > 21 indicates homology		 HPADIPDYLK
3601 614.3902 613.3829 613.3799 4.93 0 19 0.15 +1Score > 24 indicates identity LSAVPK
3739 456.7516 911.4886 911.4573 34.4 1 17 0.34 +1Score > 25 indicates identity ISEHDRR
3617 637.3237 636.3164 636.2901 41.3 0 16 0.56 +1Score > 26 indicates identity MQTGGK + Oxidation (M)
3726 435.7582 869.5018 869.4607 47.4 0 16 0.36 +1Score > 24 indicates identity VNSPSIPR + Deamidated (NQ)
3701 412.7552 823.4958 823.5028 -8.45 0 15 0.19 +1Score > 20 indicates identity RPSVLPR
3812 607.8264 1213.6382 1213.6779 -32.6 1 15 0.31 +1Score > 26 indicates identity
Score > 22 indicates homology		 TIQGLNEKGVR
3811 607.8220 1213.6294 1213.6199 7.89 1 15 0.37 +1Score > 26 indicates identity
Score > 23 indicates homology		 AGMAIVYSMKK + Oxidation (M)
3579 571.3594 570.3521 570.3489 5.59 0 15 0.18 +1Score > 20 indicates identity IVSPR
3719 428.7682 855.5218 855.5290 -8.37 1 14 0.44 +1Score > 23 indicates identity LARIDLR
3984 710.7094 2129.1064 2129.1481 -19.6 1 14 0.16 +1Score > 26 indicates identity
Score > 19 indicates homology		 YTPEIGDLVVGRIVEVQSR
4020 746.3995 2236.1767 2236.1812 -2.01 1 14 0.097 +1Score > 25 indicates identity
Score > 16 indicates homology		 NVDLDVQLDSRIGIVGPNGAGK
3898 587.3268 1758.9586 1758.9305 16.0 1 13 0.17 +1Score > 25 indicates identity
Score > 18 indicates homology		 ELLKTYPEFVHDIR
3669 374.1871 746.3596 746.3559 5.09 0 13 0.81 +1Score > 28 indicates identity
Score > 25 indicates homology		 ISQENR + Deamidated (NQ)
3876 827.9393 1653.8640 1653.8185 27.6 0 13 0.59 +1Score > 26 indicates identity
Score > 23 indicates homology		 QGGMYGYPIVAAAAAAK + Oxidation (M)
3783 537.2866 1072.5586 1072.5513 6.86 1 13 0.32 +1Score > 28 indicates identity
Score > 21 indicates homology		 LSDVDSGPKR
3532 515.3326 514.3253 514.3227 5.06 0 13 0.67 +1Score > 27 indicates identity
Score > 24 indicates homology		 LGAVR
3620 644.3196 643.3123 643.2925 30.8 0 13 0.13 +1Score > 22 indicates identity
Score > 16 indicates homology		 ADPDAR
3724 432.7027 863.3908 863.4171 -30.4 0 13 0.55 +1Score > 26 indicates identity
Score > 23 indicates homology		 GAMESLTR
3852 730.4207 1458.8268 1458.7864 27.7 1 12 0.24 +1Score > 24 indicates identity
Score > 19 indicates homology		 ISCLEVAIRAQAK + Deamidated (NQ)
3855 740.4332 1478.8518 1478.8245 18.5 1 12 0.19 +1Score > 21 indicates identity
Score > 18 indicates homology		 LLNAVAWKIHDAK + Deamidated (NQ)
3929 921.9315 1841.8484 1841.8036 24.3 1 12 0.098 +1Score > 26 indicates identity
Score > 15 indicates homology		 GISMDVNMNNTYRGPR + Oxidation (M); 2 Deamidated (NQ)
3998 725.3676 2173.0810 2172.9910 41.4 0 12 0.2 +1Score > 27 indicates identity
Score > 18 indicates homology		 NESEDIVQGTVSVPEPQTNK + 3 Deamidated (NQ)
4006 734.7357 2201.1853 2201.1480 16.9 0 12 0.32 +1Score > 25 indicates identity
Score > 20 indicates homology		 SYNLQAPPVAQKPYINLER + Deamidated (NQ)
3780 523.2928 1044.5710 1044.5862 -14.5 1 12 0.81 +1Score > 27 indicates identity
Score > 24 indicates homology		 MIVRINQR + Oxidation (M)
3727 435.7759 869.5372 869.5334 4.41 0 12 0.2 +1Score > 22 indicates identity
Score > 17 indicates homology		 VALNILAR + Deamidated (NQ)
3915 902.9895 1803.9644 1803.9003 35.6 0 12 0.13 +1Score > 26 indicates identity
Score > 15 indicates homology		 SDEQTFIAIKPDGVQR + Deamidated (NQ)
3954 984.5192 1967.0238 1967.0000 12.1 0 12 0.12 +1Score > 26 indicates identity
Score > 15 indicates homology		 ELVGGFLGIFGADQASTGTK
3902 587.6647 1759.9723 1759.9733 -0.60 0 11 0.19 +1Score > 24 indicates identity
Score > 17 indicates homology		 HAIVLAHGLLGFDELR
4289 1139.5812 3415.7218 3415.6176 30.5 0 11 0.14 +1Score > 26 indicates identity
Score > 15 indicates homology		 ASLCIENATISPNMHFENLNPDIAPYAGSLR + Deamidated (NQ)
3808 601.8443 1201.6740 1201.6390 29.2 1 11 0.4 +1Score > 25 indicates identity
Score > 20 indicates homology		 MRGQAHIVFK + Oxidation (M)
4225 744.3931 2973.5433 2973.6076 -21.6 1 11 1 +1Score > 25 indicates identity
Score > 24 indicates homology		 ELAPFNISVLVVEPGAFRTNFLSAVQR
3822 622.8259 1243.6372 1243.6044 26.4 0 11 0.19 +1Score > 27 indicates identity
Score > 16 indicates homology		 ALEQQQQLER + 2 Deamidated (NQ)
3949 971.0240 1940.0334 1940.0513 -9.20 0 11 0.2 +1Score > 25 indicates identity
Score > 16 indicates homology		 AGILIINGAGGVGAMASQIAR + Deamidated (NQ)
3683 393.2504 784.4862 784.4919 -7.22 1 11 0.8 +1Score > 23 indicates identity
Score > 22 indicates homology		 VGRLNVK
3793 550.8046 1099.5946 1099.6125 -16.2 0 10 0.33 +1Score > 27 indicates identity
Score > 18 indicates homology		 LADLGEEILK
3806 1186.6002 1185.5929 1185.5877 4.40 0 10 0.7 +1Score > 27 indicates identity
Score > 21 indicates homology		 KPIQSPSDADK + Deamidated (NQ)
4129 658.8517 2631.3777 2631.2486 49.1 1 10 0.17 +1Score > 25 indicates identity
Score > 15 indicates homology		 AINCPTQSLAPRQSFDKPDQVEK + 3 Deamidated (NQ)
4023 1130.5764 2259.1382 2259.0915 20.7 0 10 1 +1Score > 27 indicates identity
Score > 22 indicates homology		 MDIHNLATVMAPNILYPNAK + 2 Oxidation (M); 2 Deamidated (NQ)
3935 934.5526 1867.0906 1867.0277 33.7 0 10 0.5 +1Score > 19 indicates identity LLAQVALFMILTEAYR + Oxidation (M)
3831 652.3998 1302.7850 1302.7255 45.7 1 9 0.45 +1Score > 19 indicates identity ALSLGTRQSTLR + Deamidated (NQ)
4005 734.7271 2201.1595 2201.1184 18.7 0 9 0.5 +1Score > 25 indicates identity
Score > 19 indicates homology		 NSSSMLSAAILAVTALHMPQK + 2 Oxidation (M)
3910 594.9794 1781.9164 1781.8584 32.5 0 9 0.69 +1Score > 26 indicates identity
Score > 20 indicates homology		 HVHVDQSESGAFEVLK + Deamidated (NQ)
4465 904.4674 9034.6012 9034.4824 13.2 1 9 0.26 +1Score > 16 indicates identity SVNLINGIVQQQVPSTMVPLQAGIAGPYGPPVYPINAVPQQEVHGTMVPLQTGIAPQYQHGTHLPPSQGLQFSPQQHARMVQIK + Oxidation (M); 11 Deamidated (NQ)
4027 1131.0768 2260.1390 2260.0755 28.1 0 9 0.17 +1Score > 27 indicates identity
Score > 14 indicates homology		 MDIHNLATVMAPNILYPNAK + 2 Oxidation (M); 3 Deamidated (NQ)
4146 902.1434 2703.4084 2703.2843 45.9 1 9 0.22 +1Score > 25 indicates identity
Score > 15 indicates homology		 MLVESANRLNIQCNVLDAENSPAK + Oxidation (M); 2 Deamidated (NQ)
3631 661.3484 660.3411 660.3629 -32.9 0 9 0.63 +1Score > 27 indicates identity
Score > 19 indicates homology		 LMVGNK
3821 415.2615 1242.7627 1242.7084 43.6 1 8 0.66 +1Score > 19 indicates identity VNRVWQSLLK + Deamidated (NQ)
4164 922.1340 2763.3802 2763.3003 28.9 0 8 0.89 +1Score > 27 indicates identity
Score > 20 indicates homology		 VFQDWQISDDSMIFWLHGIPGAGK + Oxidation (M); Deamidated (NQ)
3873 546.6163 1636.8271 1636.7654 37.7 0 8 0.23 +1Score > 27 indicates identity
Score > 14 indicates homology		 TVQMEYPADLNDIK + Deamidated (NQ)
3771 509.7646 1017.5146 1017.4978 16.5 0 8 0.91 +1Score > 28 indicates identity
Score > 20 indicates homology		 TIANDNEIK + Deamidated (NQ)
3613 315.6835 629.3524 629.3497 4.41 0 8 0.6 +1Score > 28 indicates identity
Score > 18 indicates homology		 ADGVLR
4127 878.0958 2631.2656 2631.3730 -40.8 1 8 1 +1Score > 27 indicates identity
Score > 20 indicates homology		 IASTQFAHVLEMFLLGEIPTKNR + Oxidation (M); Deamidated (NQ)
3702 825.4310 824.4237 824.4504 -32.4 0 8 0.28 +1Score > 25 indicates identity
Score > 15 indicates homology		 KPAANPAR + Deamidated (NQ)
3645 345.2148 688.4150 688.4119 4.54 0 8 0.66 +1Score > 25 indicates identity
Score > 18 indicates homology		 QLLSTK
4114 637.7958 2547.1541 2547.1655 -4.46 1 8 0.63 +1Score > 25 indicates identity
Score > 18 indicates homology		 MAGNENLPSGIPAMTKTAAAPQCSK + 3 Deamidated (NQ)
4261 1079.5381 3235.5925 3235.6325 -12.4 0 8 1 +1Score > 26 indicates identity
Score > 20 indicates homology		 RPMLLASSAVMAAGLLTMGGLGTPSPMTTDLK + 3 Oxidation (M)
3947 956.5107 1911.0068 1910.9949 6.24 1 8 0.4 +1Score > 26 indicates identity
Score > 16 indicates homology		 LYDLGTSVADVSRSLSTK
3705 836.4501 835.4428 835.4803 -44.9 1 7 0.8 +1Score > 26 indicates identity
Score > 19 indicates homology		 KVYTTPK
4084 822.7823 2465.3251 2465.2874 15.3 1 7 0.76 +1Score > 25 indicates identity
Score > 19 indicates homology		 NQLRLSDNPAIQAGVNSLLDVAR + 2 Deamidated (NQ)
3644 688.3917 687.3844 687.3551 42.6 0 7 0.82 +1Score > 29 indicates identity
Score > 19 indicates homology		 SLSPER
3677 388.7107 775.4068 775.4341 -35.1 0 7 0.66 +1Score > 27 indicates identity
Score > 18 indicates homology		 HQLHLK + Deamidated (NQ)
4074 805.4177 2413.2313 2413.2159 6.39 1 7 0.79 +1Score > 26 indicates identity
Score > 19 indicates homology		 VDDVNDIQNLSAATPILAQRMK + 2 Deamidated (NQ)
4037 762.7178 2285.1316 2285.2341 -44.9 0 7 0.43 +1Score > 27 indicates identity
Score > 16 indicates homology		 ELQLQLEDVIILDTFPMLR
4091 832.0867 2493.2383 2493.2165 8.75 0 7 0.26 +1Score > 27 indicates identity
Score > 14 indicates homology		 MVCVPSSSSVMELANLISQSIPK + Oxidation (M); Deamidated (NQ)
3901 880.9862 1759.9578 1759.9291 16.3 1 7 0.26 +1Score > 25 indicates identity
Score > 14 indicates homology		 IQNIVGSCDIKFPIR + Deamidated (NQ)
3736 450.2714 898.5282 898.4872 45.7 1 7 0.95 +1Score > 24 indicates identity
Score > 19 indicates homology		 QVPNQKGK + Deamidated (NQ)
3871 816.4168 1630.8190 1630.8414 -13.7 0 7 0.28 +1Score > 27 indicates identity
Score > 14 indicates homology		 SLAVSTPASTQDTKPK + Deamidated (NQ)
3635 336.7069 671.3992 671.3854 20.6 0 7 1 +1Score > 26 indicates identity
Score > 19 indicates homology		 DVLTPK
3332 469.2441 468.2368 468.2445 -16.3 0 7 1 +1Score > 23 indicates identity
Score > 19 indicates homology		 AGGHK
3913 897.9158 1793.8170 1793.8838 -37.2 1 7 0.48 +1Score > 27 indicates identity
Score > 16 indicates homology		 DMILRCLIQMIQAR + 2 Oxidation (M); 2 Deamidated (NQ)
4038 1147.0577 2292.1008 2292.0943 2.85 0 7 0.83 +1Score > 27 indicates identity
Score > 18 indicates homology		 NNGMEYQDIIAEIVDNALLR + 2 Deamidated (NQ)
4113 849.7232 2546.1478 2546.2058 -22.8 0 7 0.53 +1Score > 25 indicates identity
Score > 16 indicates homology		 SDAPANTSQPLATTVIQGQASMVQK + 4 Deamidated (NQ)
4119 860.4428 2578.3066 2578.2108 37.1 0 6 0.82 +1Score > 26 indicates identity
Score > 18 indicates homology		 LLDDFQDELASLNLQLNMAEER + 2 Deamidated (NQ)
4104 842.4714 2524.3924 2524.5100 -46.6 1 6 1 +1Score > 23 indicates identity
Score > 19 indicates homology		 LQLLMTIVALTIGVVILSPMVRK + Oxidation (M); Deamidated (NQ)
4134 883.4739 2647.3999 2647.3275 27.3 1 6 1 +1Score > 25 indicates identity
Score > 19 indicates homology		 QAYQEASKAAEVENELVAQLMGLR
3785 359.8795 1076.6167 1076.5767 37.1 0 6 1 +1Score > 23 indicates identity
Score > 19 indicates homology		 SFTHAIFVR
4263 1079.5396 3235.5970 3235.6325 -11.0 0 6 1 +1Score > 26 indicates identity
Score > 19 indicates homology		 RPMLLASSAVMAAGLLTMGGLGTPSPMTTDLK + 3 Oxidation (M)
4464 1004.8471 9034.5584 9034.2385 35.4 1 6 0.54 +1Score > 16 indicates identity MLVGNIYVIAGIAVVGGALFGFDISSMSAQLNENSYKCYFNQGPQGPPFTDDADCSGPESLVQGGITASMSAGSWLGALISGPLSDR + 2 Oxidation (M); 2 Deamidated (NQ)
4103 841.7917 2522.3533 2522.2798 29.1 0 6 1 +1Score > 25 indicates identity
Score > 18 indicates homology		 VQSILESTHPMPSNASAQLAATIR + Deamidated (NQ)
4203 718.3771 2869.4793 2869.5338 -19.0 1 6 1 +1Score > 26 indicates identity
Score > 18 indicates homology		 TLLYPPSAVFLGQAQAARSGLQNVLPR + 3 Deamidated (NQ)
4199 953.8683 2858.5831 2858.4873 33.5 1 6 0.36 +1Score > 21 indicates identity
Score > 14 indicates homology		 VDILDASKDSASLAISADTSPLVSIQSR
3619 322.6631 643.3116 643.3401 -44.3 1 6 0.65 +1Score > 22 indicates identity
Score > 16 indicates homology		 PSRQR + Deamidated (NQ)
4182 932.4434 2794.3084 2794.2279 28.8 1 6 1 +1Score > 26 indicates identity
Score > 18 indicates homology		 IEREVEEDEEPDMTVHAPFYTNK + Oxidation (M); Deamidated (NQ)
3921 603.9726 1808.8960 1808.8250 39.2 0 6 0.64 +1Score > 27 indicates identity
Score > 16 indicates homology		 QNCAVYSQEVPLATAR + 3 Deamidated (NQ)
4025 1130.5834 2259.1522 2259.0668 37.8 1 6 0.69 +1Score > 26 indicates identity
Score > 16 indicates homology		 NPEWKGVHHADIESLNNAAR + 2 Deamidated (NQ)
4090 832.0859 2493.2359 2493.2165 7.79 0 6 0.78 +1Score > 27 indicates identity
Score > 17 indicates homology		 MVCVPSSSSVMELANLISQSIPK + Oxidation (M); Deamidated (NQ)
4069 797.4315 2389.2727 2389.1795 39.0 1 6 0.45 +1Score > 25 indicates identity
Score > 15 indicates homology		 QIDEQTGIIELQSRQNEMIK + Oxidation (M); Deamidated (NQ)
4003 728.0271 2181.0595 2181.0333 12.0 0 6 0.4 +1Score > 27 indicates identity
Score > 14 indicates homology		 VFVDDQEGMATILAMVNAEK + Deamidated (NQ)
4264 1079.5483 3235.6231 3235.7461 -38.0 1 5 0.58 +1Score > 26 indicates identity
Score > 16 indicates homology		 LALGLAGLIFCVGSTLQVATLGREAVMFVGR + Oxidation (M); Deamidated (NQ)
3621 324.1911 646.3676 646.3398 43.0 0 5 0.93 +1Score > 26 indicates identity
Score > 18 indicates homology		 AVTNSR
4193 950.8706 2849.5900 2849.4546 47.5 0 5 0.36 +1Score > 22 indicates identity
Score > 13 indicates homology		 LLIESGADVNVVNDSGSTPLHLLDLQK + 3 Deamidated (NQ)
4196 713.8675 2851.4409 2851.4651 -8.47 1 5 0.35 +1Score > 26 indicates identity
Score > 13 indicates homology		 LTSNITLNQWHTVHSTVKMADISVR + Deamidated (NQ)
3864 784.4481 1566.8816 1566.8981 -10.5 0 5 0.48 +1Score > 23 indicates identity
Score > 15 indicates homology		 QLLEEVEVLAGVLR
4161 918.8511 2753.5315 2753.4310 36.5 0 5 1 +1Score > 22 indicates identity
Score > 18 indicates homology		 YGLGETQIGLAFIANGVGSMIGTLVAGK + Oxidation (M); Deamidated (NQ)
Page: 1 2 3 4 5 6 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/