MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer4
MS data file : Ofer4.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:07:42 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,499

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 23 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 4376)

Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4238 661.0389 1980.0949 1980.0568 19.2 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ILDKGGFTIQYVTPGSGVK + Deamidated (NQ)
4098 1030.5388 1029.5315 1029.5454 -13.5 0 1 1 +1Score > 28 indicates identity
Score > 13 indicates homology		 QISNAQELK
4320 956.4905 2866.4497 2866.3404 38.1 0 1 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 LYNSIGGGIMLDNEPIEEMNIAWLR + Oxidation (M); 3 Deamidated (NQ)
4271 765.4217 2293.2433 2293.1518 39.9 1 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 LGYKYSVFNLVFENNVASVK + 3 Deamidated (NQ)
4474 1023.6856 7158.7483 7158.4891 36.2 1 1 3.3 +1Score > 18 indicates identity MAANNPTTRPQRPTLQESLRSNSFLHDHQQYKPAVPISSIGNVLESSLESGVGSLSLNPISPDPEK + Oxidation (M); 7 Deamidated (NQ)
4344 1002.0044 4003.9885 4003.8806 27.0 1 1 1 +1Score > 25 indicates identity
Score > 13 indicates homology		 GTYVPGNVEVYTSAWTVTHDARYFHDPYTFKPER + Deamidated (NQ)
4276 774.0006 2318.9800 2319.0915 -48.1 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 VGMNSWVLVDLSFAAMQYQK + 2 Oxidation (M); Deamidated (NQ)
4349 1013.0242 4048.0677 4047.9563 27.5 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 LNVKPPDHVQSNPSDPAKPSDTAPGGRFQSAGYQTTGPK + 2 Deamidated (NQ)
4297 864.1156 2589.3250 2589.3083 6.43 0 0 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 AAFIQMQTPDLQELNLWMVGIR + Oxidation (M)
4187 847.4483 1692.8820 1692.8519 17.8 1 0 0.96 +1Score > 26 indicates identity
Score > 13 indicates homology		 WHIVAQCPQRDVGK
4318 950.8724 2849.5954 2849.5069 31.0 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 SGMIPGPRTLANAPEITTTGGAIVPGISR + Oxidation (M)
4255 707.6904 2120.0494 2120.0055 20.7 1 0 1 +1Score > 27 indicates identity
Score > 13 indicates homology		 TVESTKSAASMQTPPPSSASR + Deamidated (NQ)
4398 616.3580 6153.5072 6153.7769 -43.8 1 0 3 +1Score > 18 indicates identity MAPIQQKALINCDMGEAYGNWACGPDLELLPMIDIANVACGFHGGDPLIMMETVR + 3 Oxidation (M); 3 Deamidated (NQ)
4285 822.7968 2465.3686 2465.4232 -22.2 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MSPFIFAVTLTFAILALGILRR + Oxidation (M)
4497 776.3424 10854.6917 10854.3317 33.2 1 0 0.98 +1Score > 13 indicates identity LYQAALTSNVTPQNVDALLSTCMFMGLTTLCPENIKPTDSWVLSDKPDAMNWLCLQSGIRCIITLAKPYLDSTIWASTFQEAHEDEVAFLEHIIK
1 300.0313 299.0240
2 300.1521 299.1448
3 300.1522 299.1449
4 300.1819 299.1746
5 300.1825 299.1752
6 300.1827 299.1754
7 300.2561 299.2488
8 301.0386 300.0313
9 301.0387 300.0314
10 301.0388 300.0315
11 301.0390 300.0317
12 301.0390 300.0317
13 301.0391 300.0318
14 301.0614 300.0541
15 301.0757 300.0684
16 301.0877 300.0804
17 301.0886 300.0813
18 301.1059 300.0986
19 301.1064 300.0991
20 301.1064 300.0991
21 301.1064 300.0991
22 301.1065 300.0992
23 301.1068 300.0995
24 301.1239 300.1166
25 301.1292 300.1219
26 301.1293 300.1220
27 301.1297 300.1224
28 301.1299 300.1226
29 301.1310 300.1237
30 301.1313 300.1240
31 301.1441 300.1368
32 301.1442 300.1369
33 301.1445 300.1372
34 301.1448 300.1375
35 302.1978 301.1905
36 302.1980 301.1907
37 302.1982 301.1909
38 302.1982 301.1909
39 302.1984 301.1911
40 302.1985 301.1912
41 302.2356 301.2283
42 302.2357 301.2284
43 302.2360 301.2287
44 303.0184 302.0111
45 303.0185 302.0112
46 303.0671 302.0598
47 303.0753 302.0680
48 303.0850 302.0777
49 303.0852 302.0779
50 303.0854 302.0781
51 303.0860 302.0787
52 303.1024 302.0951
53 303.1035 302.0962
54 303.1221 302.1148
55 303.1222 302.1149
56 303.1223 302.1150
57 303.1224 302.1151
58 303.1224 302.1151
59 303.1225 302.1152
60 303.1226 302.1153
61 303.1226 302.1153
62 303.1227 302.1154
63 303.1229 302.1156
64 303.1229 302.1156
65 303.1230 302.1157
66 303.1232 302.1159
67 303.1234 302.1161
68 303.1235 302.1162
69 303.1236 302.1163
70 303.1598 302.1525
71 303.1599 302.1526
72 303.1599 302.1526
73 303.1603 302.1530
74 303.1604 302.1531
75 303.1604 302.1531
76 303.1605 302.1532
77 303.1605 302.1532
78 303.1606 302.1533
79 303.1607 302.1534
80 303.1607 302.1534
81 303.1608 302.1535
82 303.1608 302.1535
83 303.1609 302.1536
84 303.1610 302.1537
85 303.1796 302.1723
Page: Previous 1 2 3 4 5 6 7 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/