MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Ofer4
MS data file : Ofer4.mgf
Database : A-oryzae 20191108 (12,205 sequences; 5,465,702 residues)
Timestamp : 7 May 2026 at 18:07:42 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Oxidation (M), Deamidated (NQ)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 50 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : Default
Number of queries : 4,499

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 23 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1–100 (out of 4376)

Page: 1 2 3 4 5 6 … 44 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4005 702.3932 701.3859 701.3708 21.6 0 25 0.15 +1Score > 29 indicates identity DLNAIR + Deamidated (NQ)
4022 400.2097 798.4048 798.3872 22.2 0 22 0.084 +1Score > 24 indicates identity DESHIAK
4029 408.7070 815.3994 815.4137 -17.5 0 20 0.21 +1Score > 26 indicates identity ATPVSGER
3993 672.4078 671.4005 671.3966 5.86 0 20 0.27 +1Score > 27 indicates identity AQAILR + Deamidated (NQ)
4163 720.3412 1438.6678 1438.6800 -8.46 1 18 0.35 +1Score > 26 indicates identity AENEPIPAGRDNR + Deamidated (NQ)
4018 392.7525 783.4904 783.4603 38.5 0 18 0.11 +1Score > 21 indicates identity VALPGATR
3992 335.6676 669.3206 669.3156 7.57 0 18 0.15 +1Score > 22 indicates identity SCYLK
3978 637.3242 636.3169 636.2901 42.1 0 17 0.35 +1Score > 27 indicates identity
Score > 25 indicates homology		 MQTGGK + Oxidation (M)
4224 934.5547 1867.0948 1867.0277 36.0 0 16 0.096 +1Score > 19 indicates identity LLAQVALFMILTEAYR + Oxidation (M)
3981 644.3203 643.3130 643.2925 31.8 0 16 0.16 +1Score > 22 indicates identity
Score > 21 indicates homology		 ADPDAR
4124 565.2824 1128.5502 1128.5411 8.10 0 16 0.66 +1Score > 26 indicates identity EESLPGIGDGR
4014 382.1944 762.3742 762.3872 -17.0 0 15 0.91 +1Score > 27 indicates identity VTATSER
4125 584.8083 1167.6020 1167.5924 8.26 0 15 0.2 +1Score > 26 indicates identity
Score > 21 indicates homology		 HPADIPDYLK
4006 714.3868 713.3795 713.3860 -9.14 1 15 0.24 +1Score > 23 indicates identity
Score > 21 indicates homology		 RFTYK
3953 571.3593 570.3520 570.3489 5.41 0 15 0.17 +1Score > 20 indicates identity IVSPR
3958 578.2962 577.2889 577.3071 -31.5 1 14 0.54 +1Score > 24 indicates identity KNTSK + Deamidated (NQ)
4012 743.4444 742.4371 742.4337 4.57 0 14 0.39 +1Score > 26 indicates identity
Score > 22 indicates homology		 TGLSIPR
3971 614.3914 613.3841 613.3548 47.9 1 14 0.52 +1Score > 24 indicates identity RVDPK
3990 331.1656 660.3166 660.3442 -41.8 0 13 0.54 +1Score > 27 indicates identity
Score > 23 indicates homology		 LNGTEK
4211 603.0005 1805.9797 1805.9498 16.5 1 13 0.79 +1Score > 25 indicates identity QPFWAALASTKVTVMR + Deamidated (NQ)
4051 435.7761 869.5376 869.5334 4.87 0 13 0.097 +1Score > 22 indicates identity
Score > 15 indicates homology		 VALNILAR + Deamidated (NQ)
3980 322.6636 643.3126 643.3401 -42.7 1 13 0.49 +1Score > 22 indicates identity PSRQR + Deamidated (NQ)
4016 382.7217 763.4288 763.4228 7.89 0 12 0.7 +1Score > 23 indicates identity FITNLR + Deamidated (NQ)
4101 523.2933 1044.5720 1044.5604 11.2 0 11 0.82 +1Score > 27 indicates identity
Score > 22 indicates homology		 FLVQNLGPR + 2 Deamidated (NQ)
3880 515.3337 514.3264 514.3227 7.20 0 10 0.79 +1Score > 27 indicates identity
Score > 22 indicates homology		 IGVAR
4132 607.8276 1213.6406 1213.6779 -30.7 1 9 0.2 +1Score > 26 indicates identity
Score > 15 indicates homology		 TIQGLNEKGVR
4094 509.7664 1017.5182 1017.4978 20.1 0 9 0.91 +1Score > 28 indicates identity
Score > 21 indicates homology		 TIANDNEIK + Deamidated (NQ)
4062 456.7519 911.4892 911.4573 35.0 1 9 0.9 +1Score > 25 indicates identity
Score > 21 indicates homology		 ISEHDRR
4000 345.2153 688.4160 688.3868 42.5 1 9 0.65 +1Score > 25 indicates identity
Score > 20 indicates homology		 QKQGTK
4061 450.2717 898.5288 898.5488 -22.2 1 9 0.98 +1Score > 24 indicates identity
Score > 21 indicates homology		 KVIPSIDK
4214 453.4827 1809.9017 1809.8567 24.9 1 9 1 +1Score > 27 indicates identity
Score > 21 indicates homology		 DQFSSQLTKMPDLER + Oxidation (M)
4013 743.4455 742.4382 742.4449 -9.05 1 8 0.85 +1Score > 26 indicates identity
Score > 20 indicates homology		 ALRLDR
4314 932.4465 2794.3177 2794.4031 -30.6 1 8 0.28 +1Score > 26 indicates identity
Score > 15 indicates homology		 MLQRPGSAAQRIQNKPSASEPSAPQK + Oxidation (M); 2 Deamidated (NQ)
3930 548.2646 547.2573 547.2537 6.66 0 8 0.79 +1Score > 24 indicates identity
Score > 20 indicates homology		 CGGVR
4050 432.7034 863.3922 863.4058 -15.7 0 8 0.99 +1Score > 26 indicates identity
Score > 21 indicates homology		 MQLQAEK + Oxidation (M); Deamidated (NQ)
4270 765.4216 2293.2430 2293.2794 -15.9 1 8 1 +1Score > 24 indicates identity
Score > 21 indicates homology		 RPEPSTKPIVLPFQARELSK + Deamidated (NQ)
4046 428.7682 855.5218 855.5178 4.76 0 8 0.18 +1Score > 23 indicates identity
Score > 13 indicates homology		 IAANLQVK
4307 922.1340 2763.3802 2763.3003 28.9 0 8 0.34 +1Score > 27 indicates identity
Score > 16 indicates homology		 VFQDWQISDDSMIFWLHGIPGAGK + Oxidation (M); Deamidated (NQ)
4179 813.4219 1624.8292 1624.7805 30.0 1 8 1 +1Score > 27 indicates identity
Score > 20 indicates homology		 KPQQQDAQPQARAR + 4 Deamidated (NQ)
4034 412.7555 823.4964 823.5028 -7.72 0 8 0.83 +1Score > 19 indicates identity RPSVLPR
4129 596.2908 1190.5670 1190.5779 -9.10 0 8 0.95 +1Score > 27 indicates identity
Score > 20 indicates homology		 SGTASQSISPEK
4239 663.3492 1987.0258 1986.9985 13.7 0 7 0.26 +1Score > 26 indicates identity
Score > 14 indicates homology		 LNMLHDAVINAFAPAFAR + Oxidation (M); Deamidated (NQ)
4289 832.0890 2493.2452 2493.3049 -24.0 1 7 0.64 +1Score > 27 indicates identity
Score > 18 indicates homology		 LSSRLYIFQHATSLGNVESLMK
4209 897.9174 1793.8202 1793.9094 -49.7 1 7 0.61 +1Score > 27 indicates identity
Score > 18 indicates homology		 CFLRLSQSIGSLEER
4282 797.4321 2389.2745 2389.2423 13.4 1 7 0.83 +1Score > 25 indicates identity
Score > 19 indicates homology		 QISTPSALDAAKVPSLPAQAMHR + Deamidated (NQ)
3999 688.3923 687.3850 687.3551 43.5 0 7 0.97 +1Score > 29 indicates identity
Score > 19 indicates homology		 PVTNTR + Deamidated (NQ)
3977 315.6840 629.3534 629.3497 6.00 0 7 0.71 +1Score > 28 indicates identity
Score > 18 indicates homology		 ADGVLR
4317 950.8706 2849.5900 2849.4546 47.5 0 6 0.36 +1Score > 22 indicates identity
Score > 14 indicates homology		 LLIESGADVNVVNDSGSTPLHLLDLQK + 3 Deamidated (NQ)
4134 407.5499 1219.6279 1219.6156 10.0 1 6 0.55 +1Score > 27 indicates identity
Score > 16 indicates homology		 RANESLTSQSK
4259 736.7014 2207.0824 2207.0205 28.1 0 6 0.93 +1Score > 27 indicates identity
Score > 18 indicates homology		 WSAQSAAATVYSMFTTEISR + Deamidated (NQ)
4253 695.6323 2083.8751 2083.9770 -48.9 0 6 0.67 +1Score > 23 indicates identity
Score > 16 indicates homology		 ASQAQAQAQAQAQAQAQRPK + 5 Deamidated (NQ)
4059 897.5063 896.4990 896.4967 2.57 0 5 1 +1Score > 23 indicates identity
Score > 18 indicates homology		 QPLDSPIK
4340 1168.2614 3501.7624 3501.6724 25.7 1 5 0.7 +1Score > 26 indicates identity
Score > 16 indicates homology		 MRTAQLLALSGLMLMSNVAMGAELDHDDVPNR + 2 Oxidation (M); Deamidated (NQ)
4024 402.2481 802.4816 802.4549 33.4 1 5 0.75 +1Score > 23 indicates identity
Score > 16 indicates homology		 DVQSKVK
4250 687.3572 2059.0498 2058.9844 31.7 1 5 0.82 +1Score > 27 indicates identity
Score > 17 indicates homology		 EIEIDLVNQEIKDAQGNK + 4 Deamidated (NQ)
4323 726.8860 2903.5149 2903.4884 9.11 1 4 0.95 +1Score > 25 indicates identity
Score > 17 indicates homology		 IIEIDSHMGIAIAGLASDARVLSNYMK + Oxidation (M)
4310 926.4404 2776.2994 2776.2788 7.42 1 4 0.79 +1Score > 26 indicates identity
Score > 16 indicates homology		 RFVHNNSASSSQVPSSTSTPTPSGDVK + 3 Deamidated (NQ)
4258 736.3676 2206.0810 2206.1027 -9.85 0 4 0.5 +1Score > 27 indicates identity
Score > 14 indicates homology		 MVALQTHYSYHSMVIALAR + Oxidation (M)
4213 603.9735 1808.8987 1808.8978 0.47 0 4 0.82 +1Score > 27 indicates identity
Score > 15 indicates homology		 SESVQAMVIATIEAFGR + Deamidated (NQ)
4322 958.2022 2871.5848 2871.6183 -11.7 1 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology		 ILIEPSVFNMSILLPPSLSFIQRLK + Oxidation (M); Deamidated (NQ)
4367 1144.0504 4572.1725 4572.2274 -12.0 1 4 0.78 +1Score > 24 indicates identity
Score > 15 indicates homology		 YALYHPSAEAISSMIMDMPYKIVNSILMNITLYFMANLR + 3 Oxidation (M)
4441 785.2197 7057.9118 7057.8512 8.58 1 4 1.4 +1Score > 18 indicates identity DHINIGIFLLLLASSLWPLFAVGISNQLARIPGINITILILQMAGGCLLGFALALIGTFFAAATYR + 5 Deamidated (NQ)
4249 1030.0288 2058.0430 2058.0480 -2.42 1 4 0.6 +1Score > 27 indicates identity
Score > 14 indicates homology		 ATQRQQIILAAQLEEDTK + 3 Deamidated (NQ)
4326 996.8376 2987.4910 2987.5763 -28.6 1 4 0.87 +1Score > 26 indicates identity
Score > 15 indicates homology		 VSAIAVGIQQAGALAGCLAIWPVTNRHGR + 2 Deamidated (NQ)
4266 762.7194 2285.1364 2285.1811 -19.6 1 3 0.77 +1Score > 27 indicates identity
Score > 15 indicates homology		 MIDGRPAVQDILGRHHANIR + Oxidation (M); Deamidated (NQ)
4369 691.0760 4830.4811 4830.2422 49.5 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology		 NYESLPIVFARAQGASVWDPEGNHYLDFHSASTALNHGHCHPK + Deamidated (NQ)
4487 998.7393 8979.5882 8980.0202 -48.1 1 3 0.91 +1Score > 15 indicates identity FPAFTGTVQFYFLVNTCLLVGMVAGATYAGTSSLFAAYLAGVMTSWMDDFFKENSGSGDAGNGNVSSESGTENTSQEENPTGQEK + Oxidation (M); 2 Deamidated (NQ)
4212 603.3022 1806.8848 1806.8822 1.44 0 3 0.64 +1Score > 28 indicates identity
Score > 14 indicates homology		 LEEEFINGLNAGITCK
4203 884.4014 1766.7882 1766.8323 -24.9 0 3 0.72 +1Score > 25 indicates identity
Score > 14 indicates homology		 GVSANSYPLTDSGGLNSK + Deamidated (NQ)
4113 541.2964 1080.5782 1080.5927 -13.4 0 3 0.97 +1Score > 25 indicates identity
Score > 16 indicates homology		 DHQTLNLLK
4169 514.9396 1541.7970 1541.7620 22.7 1 3 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 SVNPCNTPREVLR + Deamidated (NQ)
4127 1183.6621 1182.6548 1182.6444 8.81 1 3 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 KPPMVRHFR + Oxidation (M)
4261 746.0662 2235.1768 2235.1747 0.94 1 3 0.69 +1Score > 25 indicates identity
Score > 13 indicates homology		 LTDRITSGALGANFDSLISGVK + Deamidated (NQ)
4277 784.7314 2351.1724 2351.1501 9.48 1 2 0.91 +1Score > 26 indicates identity
Score > 14 indicates homology		 AFDDMLKEICAALLSADVNVR + Deamidated (NQ)
4056 883.5003 882.4930 882.4923 0.81 0 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 GVPENVLR
4106 529.2505 1056.4864 1056.4546 30.2 0 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 YSELMNQR + Oxidation (M); Deamidated (NQ)
4330 1010.8980 3029.6722 3029.6340 12.6 0 2 0.67 +1Score > 22 indicates identity
Score > 13 indicates homology		 GTLIFFSTFGAVSVAVMLTNIPLFIWGK + Deamidated (NQ)
4294 842.1216 2523.3430 2523.2493 37.1 1 2 0.81 +1Score > 25 indicates identity
Score > 14 indicates homology		 TTLPSWNIQFQNSTSTTPVSKGK + 2 Deamidated (NQ)
4354 1013.0295 4048.0889 4047.9063 45.1 1 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 FTDTPVLYGPKMNNVWSGGIVYMYFQEANDYGLVK + 2 Oxidation (M)
4232 638.0106 1911.0100 1910.9738 18.9 1 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 SILGFFQKSSPSTPSTAR + Deamidated (NQ)
4222 467.7422 1866.9397 1866.9410 -0.71 1 2 0.77 +1Score > 27 indicates identity
Score > 13 indicates homology		 FSMLPNTKPNQRYVR + Oxidation (M); Deamidated (NQ)
4484 998.4149 8976.6686 8977.0087 -37.9 1 2 1.4 +1Score > 16 indicates identity VASNPPPHHLNYQRQPWPSYSLPAMNGPVMTNMHNPNGQMSLVGNLQPGLFTSGQLAMQQMYGGHPSHAGHPPGPTNDRPFK + 3 Oxidation (M); 12 Deamidated (NQ)
4160 358.4491 1429.7673 1429.7664 0.62 0 2 0.76 +1Score > 27 indicates identity
Score > 13 indicates homology		 VSSEALGAVEQIVK + Deamidated (NQ)
4110 359.8793 1076.6161 1076.5767 36.6 0 2 0.84 +1Score > 23 indicates identity
Score > 14 indicates homology		 SFTHAIFVR
4137 620.7970 1239.5794 1239.5852 -4.66 1 2 0.81 +1Score > 26 indicates identity
Score > 13 indicates homology		 HAPPQMQKMR + Oxidation (M); Deamidated (NQ)
4265 762.7194 2285.1364 2285.1950 -25.7 1 2 0.77 +1Score > 27 indicates identity
Score > 13 indicates homology		 NGRMFQLTGHEEVSSLVLLR
4164 730.3838 1458.7530 1458.7977 -30.6 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 NSILGLGGGLMGRAK + Oxidation (M)
4208 894.3850 1786.7554 1786.8268 -39.9 1 1 0.8 +1Score > 24 indicates identity
Score > 13 indicates homology		 SRMTLDDNAVQLHNR + Oxidation (M); 2 Deamidated (NQ)
4281 793.0943 2376.2611 2376.1485 47.4 1 1 0.93 +1Score > 25 indicates identity
Score > 14 indicates homology		 LYNPDSPQPISAKGNELLFNR + 4 Deamidated (NQ)
4175 785.3345 1568.6544 1568.7318 -49.3 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NLDVSAPNVQGAEPR + 3 Deamidated (NQ)
4319 956.4351 2866.2835 2866.2749 2.98 1 1 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 GRIGTSEVEGEYTDIAMDPMSASHPGK + 2 Oxidation (M)
4355 1013.0316 4048.0973 4047.9063 47.2 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 FTDTPVLYGPKMNNVWSGGIVYMYFQEANDYGLVK + 2 Oxidation (M)
4492 1020.6428 9176.7197 9177.0919 -40.6 1 1 1.8 +1Score > 16 indicates identity SQEAGQLVVPASSSQMNQQPFTTPQNMFQVGQGNQTNMNGAGISPQFFSQQQLQTSQNLQQDRTQQAPQFQPQSQAQTQAQAR + 2 Oxidation (M); 12 Deamidated (NQ)
4336 818.9361 3271.7153 3271.5997 35.3 1 1 0.85 +1Score > 24 indicates identity
Score > 13 indicates homology		 RAIDAEAQADGVTGDPLGGLGGIFNDPQLFQK + 2 Deamidated (NQ)
4401 770.1974 6153.5210 6153.8212 -48.8 1 1 2.5 +1Score > 18 indicates identity APDITDLDINETVNNPMSINGLTGSVVDGAAPNANEFNITNYLIPTPETDWLFRSEG + Oxidation (M); 6 Deamidated (NQ)
4402 880.0831 6153.5308 6153.2832 40.2 1 1 2.8 +1Score > 18 indicates identity SKVFRPFGLFLLALAYTVVHATALFYQVMTLNVAVNSYSNALLSLLLSNQFVEIK + Oxidation (M); 4 Deamidated (NQ)
4241 1012.5255 2023.0364 2023.0085 13.8 0 1 0.86 +1Score > 26 indicates identity
Score > 13 indicates homology		 FGVVEGLMTAVHAYTATQK + Deamidated (NQ)
4015 382.2115 762.4084 762.4024 7.91 0 1 1 +1Score > 26 indicates identity
Score > 13 indicates homology		 YSPAVAR
4223 623.3228 1866.9466 1866.9397 3.68 1 1 1 -1Score > 27 indicates identity
Score > 13 indicates homology		 NKSTLVDMNGAVATVFAK + 2 Deamidated (NQ)
4078 972.5331 971.5258 971.5188 7.20 1 1 0.98 +1Score > 27 indicates identity
Score > 13 indicates homology		 RIWSNAPK + Deamidated (NQ)
Page: 1 2 3 4 5 6 … 44 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/