MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 801–900 (out of 7572)

Page: Previous 1 …4 5 6 7 8 9 10 11 12 13 14 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2624 589.7679 2355.0427 2355.0610 -7.78 0 2 1.7 +1Score > 17 indicates identity ETNVMPDGIQQIQTMDNYLK + 2 Deamidated (NQ); Oxidation (M)
6307 886.9030 1771.7915 1771.8233 -18.0 0 2 1.8 +1Score > 17 indicates identity VNHQVMPDVSLVDMR + Deamidated (NQ); 2 Oxidation (M)
1606 508.7311 2030.8955 2030.8626 16.2 1 2 1.4 +1Score > 16 indicates identity NDTKMTYEELEEQLNR + 3 Deamidated (NQ); Oxidation (M)
3827 684.3109 2049.9109 2049.9347 -11.6 0 2 2.8 +1Score > 19 indicates identity QMSIDADLNAGMVTEQEAK
446 414.1881 826.3617 826.3466 18.4 0 2 2.7 +1Score > 19 indicates identity MNMFER
1173 468.2127 1868.8217 1868.8325 -5.74 1 2 2.6 +1Score > 19 indicates identity AQKFVASYDSPSMMFK + Deamidated (NQ); 2 Oxidation (M)
6834 927.4214 1852.8283 1852.8414 -7.04 0 2 0.96 +1Score > 20 indicates identity
Score > 15 indicates homology		 WSGIHMTPEQSVQAHK + 2 Deamidated (NQ); Oxidation (M)
7297 967.9399 3867.7304 3867.7230 1.92 1 2 1.6 +1Score > 17 indicates identity AIGIGDASGMFPIDESTQNYNESMVKQFDELISNK + 4 Deamidated (NQ); Oxidation (M)
5470 819.3723 1636.7301 1636.7250 3.11 1 2 3 +1Score > 20 indicates identity SSKDENPLSEEMQK + Oxidation (M)
20 387.1759 1158.5058 1158.5193 -11.6 0 2 1.5 +1Score > 17 indicates identity NSTAFAADYAK + Deamidated (NQ)
1001 454.7066 907.3986 907.4069 -9.16 1 2 2.4 +1Score > 19 indicates identity MTNKNDGK + Deamidated (NQ)
1469 495.2250 1976.8708 1976.8707 0.067 1 2 2.6 +1Score > 19 indicates identity AESGYTQEKMANVLGMSK + 2 Deamidated (NQ); 2 Oxidation (M)
2378 562.7557 1123.4968 1123.5186 -19.4 0 2 1.9 +1Score > 18 indicates identity QYLEWAEGK + Deamidated (NQ)
27 387.1759 772.3372 772.3248 16.1 0 2 1.5 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
302 400.6820 1598.6989 1598.7147 -9.88 1 2 1.3 +1Score > 16 indicates identity HDSYNRASFMSGVK + Deamidated (NQ)
1236 481.7188 1922.8463 1922.8801 -17.6 0 2 1.7 +1Score > 17 indicates identity VTILYGTCGQCNCHLK
2745 603.2741 2409.0673 2409.0828 -6.41 0 2 2.7 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
5290 805.8662 1609.7179 1609.7328 -9.26 0 2 2.4 +1Score > 19 indicates identity MSQIEGMDVGDVLGK + 2 Oxidation (M)
7153 954.4337 3813.7058 3813.6621 11.4 0 2 2.4 +1Score > 19 indicates identity AMTNLASHSTSNPTSVAQYGAIAAYNGPNEPVEEMR + 4 Deamidated (NQ); 2 Oxidation (M)
42 387.1759 772.3372 772.3248 16.1 0 2 1.6 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
153 387.1759 1544.6744 1544.6824 -5.17 1 2 1.6 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
1164 468.2127 1868.8217 1868.8574 -19.1 1 2 2.6 +1Score > 19 indicates identity CEGIVLRTNDYGETNK + Deamidated (NQ)
1505 495.2250 1482.6531 1482.6701 -11.4 0 2 2.6 +1Score > 19 indicates identity NMEIDPPVNYFK + Deamidated (NQ); Oxidation (M)
2402 576.2618 2301.0183 2301.0545 -15.7 0 2 3 +1Score > 20 indicates identity DFSDVIMAFSEDPEMLALAGK + Oxidation (M)
2816 603.2741 2409.0673 2409.0641 1.32 1 2 2.7 +1Score > 19 indicates identity QAQKTMIQEENQSFLNDHTK + 4 Deamidated (NQ); Oxidation (M)
4442 738.3355 2949.3129 2949.2729 13.6 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 YRGYNPSKPNSPDNEFNWFDAVSNK + 4 Deamidated (NQ)
1090 468.2127 1868.8217 1868.8462 -13.1 1 2 2.6 +1Score > 19 indicates identity FEMLDNIETKEGAQAR + 2 Deamidated (NQ); Oxidation (M)
2308 562.7557 2246.9936 2247.0154 -9.69 0 2 1.9 +1Score > 18 indicates identity TNYQHNQMLPTQEIVFHK + 4 Deamidated (NQ); Oxidation (M)
5693 832.8785 3327.4848 3327.5309 -13.8 1 2 1.7 +1Score > 17 indicates identity GEFMNEAVPAGEGAMAAILGMDSQALKEVTDK + 3 Oxidation (M)
6469 900.4092 1798.8038 1798.8122 -4.66 0 2 2.5 +1Score > 19 indicates identity NSGQAGESFNSFAVQAGK + Deamidated (NQ)
2022 535.7434 1069.4723 1069.4676 4.36 0 2 1.6 +1Score > 17 indicates identity ETSAYTGGER
1081 468.2127 1401.6163 1401.6160 0.18 0 2 2.6 +1Score > 19 indicates identity YPHELSGGQQQR + 3 Deamidated (NQ)
1612 508.7311 2030.8955 2030.9288 -16.4 1 2 1.4 +1Score > 16 indicates identity NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M)
2780 603.2741 1204.5337 1204.5117 18.2 0 2 2.7 +1Score > 19 indicates identity MDSLHMWGGR + Oxidation (M)
884 454.7066 907.3986 907.3957 3.23 0 2 2.4 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
3945 697.8171 1393.6196 1393.6184 0.89 0 2 1.9 +1Score > 17 indicates identity MNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
5807 846.3846 2536.1319 2536.1308 0.42 1 2 2.5 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
1918 535.7434 1069.4723 1069.4750 -2.55 1 2 1.6 +1Score > 17 indicates identity MDQFKQEK + Deamidated (NQ); Oxidation (M)
87 387.1759 1544.6744 1544.6824 -5.17 1 2 1.6 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
660 427.6943 853.3741 853.3673 7.87 1 2 1.3 +1Score > 16 indicates identity NMADMKK + Deamidated (NQ); Oxidation (M)
4282 724.8293 2895.2883 2895.2903 -0.69 1 2 1.8 +1Score > 17 indicates identity DMQDSFYITEDTLMRTQTSPVQTR + Deamidated (NQ); 2 Oxidation (M)
6543 900.4092 1798.8038 1798.8023 0.86 1 2 2.5 +1Score > 19 indicates identity AYQYAEDAHREQYR
1493 495.2250 988.4354 988.4219 13.7 0 2 2.7 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
4766 765.3478 2293.0215 2293.0355 -6.09 0 2 3 +1Score > 19 indicates identity QIPEADIVNPDNCGMSTLFR + Deamidated (NQ); Oxidation (M)
21 387.1759 772.3372 772.3248 16.1 0 2 1.6 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
4774 765.3478 3057.3620 3057.3823 -6.64 0 2 3 +1Score > 19 indicates identity LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M)
5369 805.8662 1609.7179 1609.7262 -5.18 1 2 2.5 +1Score > 19 indicates identity MNTQMVIRDMNPK + Deamidated (NQ); 2 Oxidation (M)
5785 846.3846 2536.1319 2536.1362 -1.70 1 2 2.5 +1Score > 19 indicates identity FGHNEMDEPSATQPMLYDAVRK + Deamidated (NQ)
6165 873.3969 3489.5585 3489.5383 5.81 1 2 2.8 +1Score > 19 indicates identity DAAFTNASLAAMQLMIAAKAMGYDTCAMGGFDK + 3 Oxidation (M)
4690 751.8416 3003.3374 3003.2905 15.6 0 2 1.4 +1Score > 16 indicates identity MIDIHCHILAGVDDGAACMNDSLEMAK + Deamidated (NQ); Oxidation (M)
4935 778.8539 3111.3864 3111.4019 -4.98 0 2 2.2 +1Score > 18 indicates identity GDMITEQGFEFTINEIDGHHVSYVEVK + 2 Deamidated (NQ); Oxidation (M)
7208 954.4337 2860.2793 2860.2848 -1.91 1 2 2.5 +1Score > 19 indicates identity SVPNLDPKNIVIMDQNSTYYDQTGK + 5 Deamidated (NQ); Oxidation (M)
3022 616.7802 1231.5459 1231.5680 -18.0 0 2 1.9 +1Score > 17 indicates identity GDAENGESVNIK
3138 630.2864 1258.5582 1258.5396 14.8 0 2 3 +1Score > 19 indicates identity GMMEFQEMLK + Oxidation (M)
7385 967.9399 3867.7304 3867.7170 3.48 1 2 1.6 +1Score > 17 indicates identity GGITANPNYTFEQTGPASAVFSGDNGPGHQAAKQAMEK + 4 Deamidated (NQ); Oxidation (M)
752 441.2004 1760.7727 1760.8006 -15.9 0 2 3 +1Score > 19 indicates identity SVNPPDDSWVAFANNK + Deamidated (NQ)
1145 468.2127 934.4109 934.4290 -19.4 1 2 2.7 +1Score > 19 indicates identity AEGSERMR
332 400.6820 1598.6989 1598.7246 -16.1 1 2 1.4 +1Score > 16 indicates identity AENTEKMVDQYVR + Deamidated (NQ); Oxidation (M)
2826 603.2741 1204.5337 1204.5513 -14.6 0 2 2.8 +1Score > 19 indicates identity GFENGWIQPR + 2 Deamidated (NQ)
4265 724.8293 2895.2883 2895.2769 3.91 0 2 1.9 +1Score > 17 indicates identity SESGYPYIMFQDNVNNVHANNHISK + 2 Deamidated (NQ); Oxidation (M)
6082 859.8907 1717.7669 1717.7657 0.70 0 2 1.5 +1Score > 16 indicates identity MNFQTIELDTWYR + 2 Deamidated (NQ)
2019 535.7434 2138.9445 2138.9217 10.7 0 2 1.7 +1Score > 17 indicates identity TCCSSLAMAAPEVTNPVCR + Oxidation (M)
5472 819.3723 3273.4602 3273.5163 -17.1 1 2 3.1 +1Score > 20 indicates identity MTTISNAMSRQVATISSNQTVQEAAELMSR + 3 Deamidated (NQ); Oxidation (M)
5613 832.8785 3327.4848 3327.4700 4.46 1 2 1.8 +1Score > 17 indicates identity LGGGTFAQPIKLDYCHNCGDGINTPEAYEK + 3 Deamidated (NQ)
6811 927.4214 1852.8283 1852.8625 -18.4 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MQQQQFDQLTTAEKR + 2 Deamidated (NQ)
70 387.1759 1544.6744 1544.6994 -16.2 0 2 1.6 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
381 414.1881 1239.5426 1239.5549 -9.93 0 2 2.8 +1Score > 19 indicates identity MLEVVDEMMK + Oxidation (M)
589 427.6943 853.3741 853.3575 19.4 0 2 1.3 +1Score > 16 indicates identity GCMFAPR + Oxidation (M)
3817 684.3109 1366.6073 1366.6299 -16.6 0 2 3 +1Score > 19 indicates identity GNASNFTQLAGMR + Deamidated (NQ)
1243 481.7188 1922.8463 1922.8567 -5.45 0 2 1.8 +1Score > 17 indicates identity MEEQGELDHYIGTATTK + Deamidated (NQ)
5886 846.3846 1690.7546 1690.7758 -12.5 0 2 2.6 +1Score > 19 indicates identity DTNQETAASSQAVVDR
6513 900.4092 2698.2057 2698.2288 -8.55 0 2 2.6 +1Score > 19 indicates identity IMQDTMDLLHAQANLDNVQMHLK + 4 Deamidated (NQ); Oxidation (M)
6618 913.9153 1825.8160 1825.7901 14.2 1 2 2.4 +1Score > 18 indicates identity IFNSDGSEGKNCGNGLR + 2 Deamidated (NQ)
4795 765.3478 2293.0215 2293.0341 -5.51 0 2 3.1 +1Score > 19 indicates identity MTEEMNQIDVQVPEVGDVVK + 2 Deamidated (NQ); 2 Oxidation (M)
5390 805.8662 3219.4357 3219.4814 -14.2 0 2 2.5 +1Score > 19 indicates identity DIAYIMQNPMNAFTPVFTIGQQMTESIR + 4 Deamidated (NQ)
750 441.2004 880.3863 880.3960 -11.0 0 2 3 +1Score > 19 indicates identity DAMASGVSK + Oxidation (M)
2272 562.7557 1123.4968 1123.5002 -3.00 0 2 2.1 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
2445 576.2618 1725.7637 1725.7735 -5.71 1 2 3.2 +1Score > 20 indicates identity MLSKDMQNVLDEMR + Deamidated (NQ); Oxidation (M)
3483 657.2986 1312.5827 1312.5791 2.74 0 2 3.1 +1Score > 19 indicates identity MEEIFTICDR
3514 657.2986 1312.5827 1312.5857 -2.24 0 2 3.1 +1Score > 19 indicates identity ADDFDIETMIK + Oxidation (M)
5282 805.8662 3219.4357 3219.4873 -16.0 1 2 2.6 +1Score > 19 indicates identity HIGVPYRWGGNNPSGFDCSGFIYYTLNK + Deamidated (NQ)
7154 954.4337 3813.7058 3813.7739 -17.9 1 2 2.6 +1Score > 19 indicates identity MASFMGKCILACAVMFFGVLLGMQQANNGMIEMK + Oxidation (M)
7344 967.9399 3867.7304 3867.7446 -3.67 0 2 1.7 +1Score > 17 indicates identity SALGSGAGNTGDFLIVNNGINATNYIDPDVSDQNVVGNA + 5 Deamidated (NQ)
1638 508.7311 2030.8955 2030.9003 -2.40 1 2 1.5 +1Score > 16 indicates identity YEKMLNTYSHQEETSR + Oxidation (M)
2982 616.7802 1231.5459 1231.5316 11.6 1 2 1.9 +1Score > 17 indicates identity NPANRQTDGQK + 4 Deamidated (NQ)
3141 630.2864 2517.1164 2517.1466 -12.0 0 2 3 +1Score > 19 indicates identity AAQTNSAAGSEAVSNEQPAESGEALK + Deamidated (NQ)
2111 549.2496 1096.4846 1096.4827 1.69 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MCSLCNGKK
5132 792.3600 1582.7055 1582.7218 -10.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VIAQMESDMKEAAK + Deamidated (NQ); 2 Oxidation (M)
5803 846.3846 2536.1319 2536.1619 -11.8 0 2 2.6 +1Score > 19 indicates identity DPHTQNYYTGFAHGTSGIAAALSR + 2 Deamidated (NQ)
3380 643.7925 2571.1411 2571.1410 0.028 1 2 2 +1Score > 18 indicates identity FGAGYVIEYTGEVFRNMSMDER + Deamidated (NQ)
469 414.1881 1652.7235 1652.7406 -10.4 0 2 2.9 +1Score > 19 indicates identity FGFFEPHQIDMNR + Oxidation (M)
569 427.6943 1706.7481 1706.7668 -11.0 0 2 1.4 +1Score > 16 indicates identity MTEQNAIDQIEQLR + 3 Deamidated (NQ); Oxidation (M)
3285 643.7925 2571.1411 2571.1621 -8.19 1 2 2 +1Score > 18 indicates identity YKGLGEMNATQLWETTMDPETR + Deamidated (NQ)
26 387.1759 1158.5058 1158.5193 -11.6 0 2 1.7 +1Score > 17 indicates identity NSTAFAADYAK + Deamidated (NQ)
1327 481.7188 961.4231 961.4175 5.88 0 2 1.9 +1Score > 17 indicates identity EGEAVCLNA
3852 684.3109 1366.6073 1366.6300 -16.6 0 2 3.1 +1Score > 19 indicates identity DDVHVEPAAVCR
6247 873.3969 3489.5585 3489.5102 13.8 1 2 2.9 +1Score > 19 indicates identity SMLMGSSDSDNYNRTITFHHNWFENLNSR + Deamidated (NQ); Oxidation (M)
1384 495.2250 988.4354 988.4219 13.7 0 2 2.8 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
985 454.7066 1814.7972 1814.8033 -3.34 0 2 2.6 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
2087 549.2496 2192.9692 2192.9792 -4.57 0 2 0.87 +1Score > 20 indicates identity
Score > 14 indicates homology		 NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M)
Page: Previous 1 …4 5 6 7 8 9 10 11 12 13 14 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/