MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues) |
| Timestamp | : | 4 Dec 2025 at 15:32:34 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 441 |
414.1881 | 826.3617 | 826.3643 | -3.15 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
MYVDGAR + Oxidation (M) |
| 1628 |
508.7311 | 2030.8955 | 2030.8851 | 5.12 | 1 | 3 | 1.3 | 1Score > 16 indicates identity |
MGNEDNQKQPEELEQNK + Deamidated (NQ) |
| 2121 |
549.2496 | 2192.9692 | 2192.9871 | -8.15 | 0 | 3 | 0.67 | 1Score > 20 indicates identity Score > 13 indicates homology |
DYYEHVHMIPTMIQLDR + Deamidated (NQ); 2 Oxidation (M) |
| 3467 |
657.2986 | 2625.1655 | 2625.1396 | 9.84 | 1 | 3 | 2.6 | 1Score > 19 indicates identity |
NMKSIQYPHMPEEGMTEESEVK + 2 Oxidation (M) |
| 5946 |
859.8907 | 3435.5339 | 3435.5551 | -6.18 | 1 | 3 | 1.3 | 1Score > 16 indicates identity |
TQMLNKQYEAVERPQQTDAAEFTFAQLEK + 6 Deamidated (NQ); Oxidation (M) |
| 825 |
441.2004 | 880.3863 | 880.3926 | -7.15 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
ANEQYEK |
| 874 |
454.7066 | 907.3986 | 907.3957 | 3.23 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
EMNGLAEK + Deamidated (NQ); Oxidation (M) |
| 5111 |
792.3600 | 1582.7055 | 1582.6967 | 5.59 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
NSSMVLMAGEVAEGR + Deamidated (NQ); 2 Oxidation (M) |
| 3270 |
643.7925 | 1285.5705 | 1285.5833 | -9.95 | 0 | 3 | 1.7 | 1Score > 18 indicates identity |
NASHGMVGDLNR + Oxidation (M) |
| 5131 |
792.3600 | 1582.7055 | 1582.7218 | -10.3 | 1 | 3 | 0.85 | 1Score > 20 indicates identity Score > 15 indicates homology |
VIAQMESDMKEAAK + Deamidated (NQ); 2 Oxidation (M) |
| 60 |
387.1759 | 1544.6744 | 1544.6824 | -5.17 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
CQHCQKNEATIR + Deamidated (NQ) |
| 2079 |
549.2496 | 2192.9692 | 2192.9644 | 2.20 | 1 | 3 | 0.68 | 1Score > 20 indicates identity Score > 14 indicates homology |
IAEEGSHQELMDKNGEYSR + Deamidated (NQ) |
| 5800 |
846.3846 | 2536.1319 | 2536.1308 | 0.42 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M) |
| 2370 |
562.7557 | 1123.4968 | 1123.5002 | -3.00 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
GNMAVAMATGGK + Deamidated (NQ); Oxidation (M) |
| 4202 |
711.3232 | 1420.6319 | 1420.6504 | -13.0 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
DAMDGLSLANQLR + 2 Deamidated (NQ); Oxidation (M) |
| 4357 |
724.8293 | 1447.6441 | 1447.6474 | -2.23 | 1 | 3 | 1.6 | 1Score > 17 indicates identity |
NVNDRMNVTDNR + Deamidated (NQ) |
| 5702 |
832.8785 | 3327.4848 | 3327.4765 | 2.51 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
FNFANEEDMYAAVGYNGITAAQVANRLTEK + 5 Deamidated (NQ); Oxidation (M) |
| 2103 |
549.2496 | 1644.7269 | 1644.7487 | -13.3 | 0 | 3 | 0.74 | 1Score > 20 indicates identity Score > 14 indicates homology |
MSATVAGMAINFTGNK + Deamidated (NQ); 2 Oxidation (M) |
| 2245 |
562.7557 | 1123.4968 | 1123.5002 | -3.00 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
GNMAVAMATGGK + Deamidated (NQ); Oxidation (M) |
| 384 |
414.1881 | 826.3617 | 826.3564 | 6.40 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
MKMEEK + 2 Oxidation (M) |
| 1086 |
468.2127 | 1868.8217 | 1868.8462 | -13.1 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M) |
| 1938 |
535.7434 | 1069.4723 | 1069.4750 | -2.55 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
MDQFKQEK + Deamidated (NQ); Oxidation (M) |
| 3795 |
684.3109 | 2733.2145 | 2733.2084 | 2.24 | 1 | 3 | 2.6 | 1Score > 19 indicates identity |
MQDIIYCEGANRFPGVDTEQVMK + Deamidated (NQ); 2 Oxidation (M) |
| 3938 |
697.8171 | 1393.6196 | 1393.6282 | -6.19 | 0 | 3 | 1.7 | 1Score > 17 indicates identity |
QLNMSVDQLAQK + 4 Deamidated (NQ); Oxidation (M) |
| 6617 |
913.9153 | 3651.6320 | 3651.6991 | -18.4 | 1 | 3 | 2.1 | 1Score > 18 indicates identity |
EFDIITTGDYQLILEDDQELYAYLRNGADEK + 2 Deamidated (NQ) |
| 470 |
414.1881 | 1652.7235 | 1652.7273 | -2.35 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
VDQMMDEGLLDEVK + 2 Oxidation (M) |
| 2829 |
603.2741 | 1204.5337 | 1204.5360 | -1.95 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
QINDTYGHQK + 2 Deamidated (NQ) |
| 2854 |
603.2741 | 1204.5337 | 1204.5394 | -4.75 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
MSGAETIHNTK + Deamidated (NQ); Oxidation (M) |
| 1011 |
454.7066 | 907.3986 | 907.4069 | -9.14 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
QEAERMK + Deamidated (NQ); Oxidation (M) |
| 4601 |
751.8416 | 3003.3374 | 3003.3808 | -14.5 | 1 | 3 | 1.2 | 1Score > 16 indicates identity |
RSFDIQDGVIEMGEFSPVVDQSFQEK + Deamidated (NQ); Oxidation (M) |
| 5164 |
792.3600 | 3165.4111 | 3165.3704 | 12.8 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
WNGLADLKLMNMMGYDAMTFGNHEFDK + Deamidated (NQ); Oxidation (M) |
| 930 |
454.7066 | 907.3986 | 907.3957 | 3.22 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
MDQQQLK + 2 Deamidated (NQ); Oxidation (M) |
| 4124 |
711.3232 | 2130.9479 | 2130.9481 | -0.083 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
LYDGESVEGYNSVDVEDLK + Deamidated (NQ) |
| 918 |
454.7066 | 1814.7972 | 1814.8033 | -3.34 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
GFIYIEECEDQNGIK + Deamidated (NQ) |
| 5113 |
792.3600 | 2374.0583 | 2374.0821 | -10.0 | 1 | 3 | 0.92 | 1Score > 20 indicates identity Score > 15 indicates homology |
QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M) |
| 5576 |
819.3723 | 1636.7301 | 1636.7104 | 12.0 | 0 | 3 | 2.8 | 1Score > 20 indicates identity |
QEENPAFSQLTDEK + 2 Deamidated (NQ) |
| 7259 |
954.4337 | 1906.8529 | 1906.8255 | 14.4 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
FYDMDELTGSLETQSR + Oxidation (M) |
| 3086 |
630.2864 | 1258.5582 | 1258.5396 | 14.8 | 0 | 3 | 2.7 | 1Score > 19 indicates identity |
GMMEFQEMLK + Oxidation (M) |
| 3598 |
670.8048 | 2679.1901 | 2679.1945 | -1.61 | 1 | 3 | 2.1 | 1Score > 18 indicates identity |
DDFYNEYGIRIQGNLSPLNMMR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 6288 |
886.9030 | 3543.5830 | 3543.6538 | -20.0 | 1 | 3 | 1.7 | 1Score > 17 indicates identity |
CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK + Deamidated (NQ) |
| 2403 |
576.2618 | 2301.0183 | 2301.0545 | -15.7 | 0 | 3 | 2.8 | 1Score > 20 indicates identity |
DFSDVIMAFSEDPEMLALAGK + Oxidation (M) |
| 4356 |
724.8293 | 2895.2883 | 2895.3419 | -18.5 | 1 | 3 | 1.7 | 1Score > 17 indicates identity |
VFELRQDSWTDPDTNVIMPQMSIR + 2 Deamidated (NQ); Oxidation (M) |
| 2204 |
549.2496 | 1096.4846 | 1096.5005 | -14.5 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
NMTVKDSMR + Oxidation (M) |
| 901 |
454.7066 | 907.3986 | 907.4035 | -5.44 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
EEAADAFR |
| 1319 |
481.7188 | 961.4231 | 961.4240 | -0.88 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
DELEQAEK + Deamidated (NQ) |
| 1413 |
495.2250 | 1482.6531 | 1482.6296 | 15.8 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
EITPYQNAMNQR + 3 Deamidated (NQ); Oxidation (M) |
| 1794 |
522.2372 | 1563.6899 | 1563.7198 | -19.1 | 1 | 3 | 2.6 | 1Score > 19 indicates identity |
ASERLNEAMNNGLK + 2 Deamidated (NQ); Oxidation (M) |
| 4588 |
751.8416 | 3003.3374 | 3003.3710 | -11.2 | 0 | 3 | 1.3 | 1Score > 16 indicates identity |
HILWENIAVYLYWMYDMLQEDPK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 5126 |
792.3600 | 3165.4111 | 3165.3862 | 7.86 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MIEQASMTPGTIFMSSQVTAPTEEDMLR + Deamidated (NQ); 4 Oxidation (M) |
| 5127 |
792.3600 | 1582.7055 | 1582.6967 | 5.59 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
NSSMVLMAGEVAEGR + Deamidated (NQ); 2 Oxidation (M) |
| 1085 |
468.2127 | 934.4109 | 934.4178 | -7.41 | 1 | 2 | 2.4 | 1Score > 19 indicates identity |
MQNKAADR + 2 Deamidated (NQ) |
| 2015 |
535.7434 | 2138.9445 | 2138.9797 | -16.4 | 1 | 2 | 1.5 | 1Score > 17 indicates identity |
TFSTFNVYDTVPNDYKAR + 2 Deamidated (NQ) |
| 1734 |
522.2372 | 2084.9199 | 2084.9468 | -12.9 | 0 | 2 | 2.6 | 1Score > 19 indicates identity |
EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M) |
| 1904 |
535.7434 | 2138.9445 | 2138.9547 | -4.75 | 1 | 2 | 1.5 | 1Score > 17 indicates identity |
IRASQLNGCAFCLNMHTK + 3 Deamidated (NQ); Oxidation (M) |
| 4434 |
738.3355 | 2949.3129 | 2949.3662 | -18.0 | 1 | 2 | 0.98 | 1Score > 20 indicates identity Score > 15 indicates homology |
INFTLDSRYNMPGISITTNSQNSTTR + 3 Deamidated (NQ); Oxidation (M) |
| 582 |
427.6943 | 853.3741 | 853.3575 | 19.4 | 0 | 2 | 1.2 | 1Score > 16 indicates identity |
GCMFAPR + Oxidation (M) |
| 2234 |
562.7557 | 1123.4968 | 1123.5002 | -3.00 | 0 | 2 | 1.8 | 1Score > 18 indicates identity |
GMGIIGMEER + 2 Oxidation (M) |
| 2479 |
576.2618 | 1150.5091 | 1150.5176 | -7.33 | 1 | 2 | 2.8 | 1Score > 20 indicates identity |
AGEKLNEDMK + Deamidated (NQ); Oxidation (M) |
| 6917 |
927.4214 | 2779.2425 | 2779.2581 | -5.62 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
FKNASGFQAGNFQLSQSMDAAGMINK + 2 Deamidated (NQ); Oxidation (M) |
| 251 |
400.6820 | 1598.6989 | 1598.7246 | -16.1 | 0 | 2 | 1.2 | 1Score > 16 indicates identity |
YNATPSQDAMLSTGK + Oxidation (M) |
| 1417 |
495.2250 | 1976.8708 | 1976.8859 | -7.65 | 1 | 2 | 2.5 | 1Score > 19 indicates identity |
LYEEKMTDYPAMALDR + 2 Oxidation (M) |
| 3087 |
630.2864 | 1887.8373 | 1887.8639 | -14.1 | 0 | 2 | 2.7 | 1Score > 19 indicates identity |
QFQEVEAVTFQYNQR + 2 Deamidated (NQ) |
| 3868 |
684.3109 | 1366.6073 | 1366.5856 | 15.8 | 1 | 2 | 2.7 | 1Score > 19 indicates identity |
KMIEMNQGQNR + 3 Deamidated (NQ); Oxidation (M) |
| 6501 |
900.4092 | 3597.6076 | 3597.5857 | 6.09 | 1 | 2 | 2.4 | 1Score > 19 indicates identity |
HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M) |
| 4775 |
765.3478 | 2293.0215 | 2293.0597 | -16.7 | 0 | 2 | 2.8 | 1Score > 19 indicates identity |
QQVDYNDDSIQVLEGLEAVR + 3 Deamidated (NQ) |
| 2508 |
576.2618 | 1150.5091 | 1150.5063 | 2.45 | 0 | 2 | 2.9 | 1Score > 20 indicates identity |
MNQIQLEEK + 3 Deamidated (NQ); Oxidation (M) |
| 2748 |
603.2741 | 1806.8005 | 1806.8029 | -1.32 | 1 | 2 | 2.6 | 1Score > 19 indicates identity |
KAHFMADQCQDQSLK + Deamidated (NQ) |
| 3940 |
697.8171 | 1393.6196 | 1393.6282 | -6.19 | 0 | 2 | 1.8 | 1Score > 17 indicates identity |
QLNMSVDQLAQK + 4 Deamidated (NQ); Oxidation (M) |
| 5042 |
778.8539 | 1555.6932 | 1555.7076 | -9.23 | 0 | 2 | 2.1 | 1Score > 18 indicates identity |
TSMLEVYNPATGEK + Deamidated (NQ); Oxidation (M) |
| 5227 |
792.3600 | 1582.7055 | 1582.7330 | -17.4 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MNEKSAASEMLQTK + Oxidation (M) |
| 1837 |
522.2372 | 1563.6899 | 1563.6922 | -1.48 | 0 | 2 | 2.7 | 1Score > 19 indicates identity |
HPGMGMQPPQAQQR + 2 Deamidated (NQ) |
| 2316 |
562.7557 | 2246.9936 | 2247.0114 | -7.91 | 1 | 2 | 1.9 | 1Score > 18 indicates identity |
SKDEFGQLGTSFNEMADSLR + Oxidation (M) |
| 6376 |
886.9030 | 3543.5830 | 3543.6470 | -18.1 | 1 | 2 | 1.7 | 1Score > 17 indicates identity |
SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ) |
| 1583 |
508.7311 | 2030.8955 | 2030.9003 | -2.40 | 1 | 2 | 1.3 | 1Score > 16 indicates identity |
YEKMLNTYSHQEETSR + Oxidation (M) |
| 2095 |
549.2496 | 1096.4846 | 1096.4785 | 5.56 | 0 | 2 | 0.94 | 1Score > 20 indicates identity Score > 15 indicates homology |
YTNATDADAR |
| 6504 |
900.4092 | 2698.2057 | 2698.2122 | -2.39 | 1 | 2 | 2.4 | 1Score > 19 indicates identity |
NDPMWPYLENKYQTSWNPNTGK + Oxidation (M) |
| 940 |
454.7066 | 907.3986 | 907.4069 | -9.16 | 0 | 2 | 2.3 | 1Score > 19 indicates identity |
NMEQTIR + Deamidated (NQ); Oxidation (M) |
| 2400 |
576.2618 | 2301.0183 | 2301.0205 | -0.98 | 1 | 2 | 2.9 | 1Score > 20 indicates identity |
LSNEKAYQEINDTQEMIEK + 3 Deamidated (NQ); Oxidation (M) |
| 2439 |
576.2618 | 1150.5091 | 1150.5254 | -14.2 | 1 | 2 | 2.9 | 1Score > 20 indicates identity |
ALYNRGVNDE + Deamidated (NQ) |
| 3365 |
643.7925 | 2571.1411 | 2571.1509 | -3.82 | 1 | 2 | 1.8 | 1Score > 18 indicates identity |
KMELEDADVLCQYWSDPEVTK + Oxidation (M) |
| 3136 |
630.2864 | 1258.5582 | 1258.5612 | -2.37 | 0 | 2 | 2.8 | 1Score > 19 indicates identity |
GTGNMELHLDR + Deamidated (NQ); Oxidation (M) |
| 4358 |
724.8293 | 2895.2883 | 2895.3419 | -18.5 | 1 | 2 | 1.7 | 1Score > 17 indicates identity |
VFELRQDSWTDPDTNVIMPQMSIR + 2 Deamidated (NQ); Oxidation (M) |
| 870 |
454.7066 | 1814.7972 | 1814.8257 | -15.7 | 1 | 2 | 2.3 | 1Score > 19 indicates identity |
LLDNAFRYADQMGQR + 2 Deamidated (NQ); Oxidation (M) |
| 4433 |
738.3355 | 2949.3129 | 2949.2974 | 5.26 | 0 | 2 | 0.64 | 1Score > 20 indicates identity Score > 13 indicates homology |
TAVSCYPNAGLPDEEGQYHESPQSLAK + 2 Deamidated (NQ) |
| 676 |
427.6943 | 1706.7481 | 1706.7345 | 8.00 | 0 | 2 | 1.2 | 1Score > 16 indicates identity |
EAALVNYNNTYSMSK + 3 Deamidated (NQ) |
| 922 |
454.7066 | 1814.7972 | 1814.8186 | -11.8 | 0 | 2 | 2.3 | 1Score > 19 indicates identity |
GTFTMVFDHYEEVPK + Oxidation (M) |
| 4096 |
711.3232 | 2130.9479 | 2130.9635 | -7.33 | 1 | 2 | 2.8 | 1Score > 19 indicates identity |
MDNQVLQAIYEMQKEMK + Deamidated (NQ); 2 Oxidation (M) |
| 4486 |
738.3355 | 2211.9847 | 2212.0072 | -10.2 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
AAAYIQFDEEGQQQLWSAR + 2 Deamidated (NQ) |
| 3520 |
657.2986 | 1312.5827 | 1312.5574 | 19.3 | 0 | 2 | 2.9 | 1Score > 19 indicates identity |
MQTGMSVQEMR + Oxidation (M) |
| 4431 |
738.3355 | 2949.3129 | 2949.2974 | 5.26 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
TAVSCYPNAGLPDEEGQYHESPQSLAK + 2 Deamidated (NQ) |
| 813 |
441.2004 | 880.3863 | 880.3926 | -7.17 | 0 | 2 | 2.8 | 1Score > 19 indicates identity |
GEDELYR |
| 931 |
454.7066 | 1814.7972 | 1814.7815 | 8.65 | 0 | 2 | 2.3 | 1Score > 19 indicates identity |
QLPSDSSEDFMQMLR + 2 Oxidation (M) |
| 2069 |
549.2496 | 1644.7269 | 1644.7487 | -13.3 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MSATVAGMAINFTGNK + Deamidated (NQ); 2 Oxidation (M) |
| 7129 |
954.4337 | 3813.7058 | 3813.7609 | -14.5 | 1 | 2 | 2.4 | 1Score > 19 indicates identity |
NMSFTLDDFLEQLGQVRNMGPLEDLIQMMPGAGK + 3 Deamidated (NQ); Oxidation (M) |
| 7150 |
954.4337 | 2860.2793 | 2860.3233 | -15.4 | 1 | 2 | 2.4 | 1Score > 19 indicates identity |
KPAHAAMMLIPEPWNENPYMSKEK + Deamidated (NQ); 3 Oxidation (M) |
| 301 |
400.6820 | 1598.6989 | 1598.6812 | 11.1 | 0 | 2 | 1.3 | 1Score > 16 indicates identity |
MLMQVMQDPEMAK + 3 Oxidation (M) |
| 380 |
414.1881 | 1239.5426 | 1239.5264 | 13.1 | 0 | 2 | 2.7 | 1Score > 19 indicates identity |
EEMEFMGPVR + Oxidation (M) |
| 437 |
414.1881 | 826.3617 | 826.3466 | 18.4 | 0 | 2 | 2.7 | 1Score > 19 indicates identity |
MNMFER |
| 6454 |
900.4092 | 2698.2057 | 2698.2387 | -12.2 | 0 | 2 | 2.4 | 1Score > 19 indicates identity |
GSILKPDEMDTLSGNQETAMGVMLK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 2436 |
576.2618 | 1150.5091 | 1150.5077 | 1.25 | 0 | 2 | 2.9 | 1Score > 20 indicates identity |
NMGDPLFANR + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/