| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues) |
| Timestamp | : | 4 Dec 2025 at 15:32:34 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 630.2864 | 2517.1164 | 2517.1516 | -14.0 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
SGRQGDPGITQFYLSMEDELMK + Oxidation (M) | |
| 792.3600 | 1582.7055 | 1582.7045 | 0.64 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 16 indicates homology |
CQYETLVENNRR + 2 Deamidated (NQ) | |
| 508.7311 | 2030.8955 | 2030.9142 | -9.25 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
EAGLSDEEALMYAFEAGTK | |
| 576.2618 | 2301.0183 | 2301.0252 | -3.03 | 1 | 3 | 2.3 | 1Score > 20 indicates identity |
NAKTQSLACVASYEAMANNEK + 2 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9765 | -14.9 | 0 | 3 | 1.3 | 1Score > 17 indicates identity |
QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ) | |
| 670.8048 | 1339.5951 | 1339.6190 | -17.9 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
KDSGFQMNQLR + Deamidated (NQ); Oxidation (M) | |
| 900.4092 | 3597.6076 | 3597.5857 | 6.09 | 1 | 3 | 2 | 1Score > 19 indicates identity |
HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.8295 | -14.3 | 1 | 3 | 2 | 1Score > 19 indicates identity |
MSKEQLSFLDDVDEK + Oxidation (M) | |
| 913.9153 | 1825.8160 | 1825.8516 | -19.5 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
MVDQYVRNLNSDLNK + 2 Deamidated (NQ); Oxidation (M) | |
| 697.8171 | 2787.2392 | 2787.2255 | 4.93 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
NMNQAMAYIEEHLTDSIDFQTVAK + 3 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 3057.3620 | 3057.4140 | -17.0 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
LIPYDVTIFQTPCFGEDKGYEMVYR + Deamidated (NQ); Oxidation (M) | |
| 508.7311 | 1015.4477 | 1015.4610 | -13.1 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
EWAQQPEK + Deamidated (NQ) | |
| 522.2372 | 1563.6899 | 1563.7086 | -12.0 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
LEKNGEMTEDELR + Deamidated (NQ) | |
| 522.2372 | 1042.4599 | 1042.4753 | -14.8 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
MTDASLSFR + Oxidation (M) | |
| 603.2741 | 1204.5337 | 1204.5144 | 16.0 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
QMFFQDIMK + 2 Deamidated (NQ); Oxidation (M) | |
| 481.7188 | 1922.8463 | 1922.8801 | -17.6 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
VTILYGTCGQCNCHLK | |
| 454.7066 | 907.3986 | 907.4069 | -9.18 | 0 | 3 | 1.9 | 1Score > 19 indicates identity |
MESGETVR | |
| 468.2127 | 1868.8217 | 1868.8284 | -3.59 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
IDDMRDNEFPIMETK + Oxidation (M) | |
| 765.3478 | 1528.6810 | 1528.7079 | -17.6 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
FNPDSSLSLMTSSK + Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7496 | -0.85 | 0 | 3 | 1 | 1Score > 16 indicates identity |
GAAGDNGIYNQDLNER + Deamidated (NQ) | |
| 954.4337 | 2860.2793 | 2860.3254 | -16.1 | 1 | 3 | 2 | 1Score > 19 indicates identity |
NEIYVLCMEEDIMKVVNLLMENK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 481.7188 | 961.4231 | 961.4240 | -0.88 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
DELEQAEK + Deamidated (NQ) | |
| 481.7188 | 1922.8463 | 1922.8680 | -11.3 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
NKDEIGDLGDDFNIMAR + Deamidated (NQ) | |
| 549.2496 | 1096.4846 | 1096.5011 | -15.1 | 1 | 3 | 0.98 | 1Score > 20 indicates identityScore > 16 indicates homology |
MKSSYFYR + Oxidation (M) | |
| 522.2372 | 1563.6899 | 1563.7208 | -19.7 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
MCPVCNGILVQTR + Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1652.7235 | 1652.7273 | -2.35 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
VDQMMDEGLLDEVK + 2 Oxidation (M) | |
| 468.2127 | 934.4109 | 934.4066 | 4.58 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
DATPEQMK + Oxidation (M) | |
| 495.2250 | 1482.6531 | 1482.6634 | -6.93 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
QTDSSKQVHHCR + Deamidated (NQ) | |
| 495.2250 | 1976.8708 | 1976.9084 | -19.0 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
ISPGMSPDAFGKMVEHSR + 2 Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.8626 | 16.2 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
ASELETAFQTASSNANQMK + 4 Deamidated (NQ) | |
| 468.2127 | 934.4109 | 934.4290 | -19.4 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
AEGSERMR | |
| 616.7802 | 1231.5459 | 1231.5469 | -0.83 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
NDRNATWPEK + 2 Deamidated (NQ) | |
| 481.7188 | 961.4231 | 961.4101 | 13.6 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
ERDEEER | |
| 414.1881 | 1239.5426 | 1239.5230 | 15.8 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
IYYGNYGSMR + Deamidated (NQ); Oxidation (M) | |
| 657.2986 | 2625.1655 | 2625.1408 | 9.40 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ) | |
| 387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 3 | 1.3 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9295 | -4.63 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
VFQGKNEQGMAHAAMAYSK + 2 Deamidated (NQ); Oxidation (M) | |
| 562.7557 | 1123.4968 | 1123.5002 | -3.00 | 0 | 3 | 1.6 | 1Score > 18 indicates identity |
GNMAVAMATGGK + Deamidated (NQ); Oxidation (M) | |
| 589.7679 | 1177.5213 | 1177.5325 | -9.47 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
MNWEQEVLK + 2 Deamidated (NQ) | |
| 657.2986 | 1968.8741 | 1968.8912 | -8.69 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
QSGLSSDFIELSEATNDR + Deamidated (NQ) | |
| 441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
DNNRVGFAEAAR + 2 Deamidated (NQ) | |
| 414.1881 | 1652.7235 | 1652.7318 | -5.07 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
AGTEGEGGWVDQVYGK + Deamidated (NQ) | |
| 657.2986 | 1312.5827 | 1312.5856 | -2.22 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
ELNVMTYGEEK + Deamidated (NQ) | |
| 765.3478 | 2293.0215 | 2293.0359 | -6.29 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9797 | -16.4 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
TFSTFNVYDTVPNDYKAR + 2 Deamidated (NQ) | |
| 589.7679 | 2355.0427 | 2355.0762 | -14.2 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
EMQLLHNFALLYAAMDNSEK + 2 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 2293.0215 | 2293.0359 | -6.29 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ) | |
| 468.2127 | 934.4109 | 934.4290 | -19.4 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
AEGSERMR | |
| 562.7557 | 2246.9936 | 2247.0300 | -16.2 | 1 | 3 | 1.6 | 1Score > 18 indicates identity |
DAWANLGGHMSVKMTEEEVK + Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.5077 | 1.25 | 0 | 3 | 2.5 | 1Score > 20 indicates identity |
NMGDPLFANR + Deamidated (NQ); Oxidation (M) | |
| 738.3355 | 2949.3129 | 2949.2565 | 19.1 | 0 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
TFNEDETMLSQSINMLAQNLQDMTR + 4 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 1528.6810 | 1528.6688 | 7.97 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
VTAGNHCDNLRNR + 3 Deamidated (NQ) | |
| 846.3846 | 3381.5092 | 3381.4978 | 3.37 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
GTPFIYQGEEIGMTNSEMPLEMYDDLEIK + 2 Oxidation (M) | |
| 603.2741 | 2409.0673 | 2409.0828 | -6.41 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7466 | 0.88 | 1 | 3 | 1.1 | 1Score > 16 indicates identity |
QYMPMICFSAGNKK + Deamidated (NQ); 2 Oxidation (M) | |
| 562.7557 | 2246.9936 | 2247.0331 | -17.6 | 1 | 3 | 1.6 | 1Score > 18 indicates identity |
QLDSFVDNVNQYKQYQEK + 2 Deamidated (NQ) | |
| 468.2127 | 1401.6163 | 1401.6268 | -7.49 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
DKAEEMITMYR + Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8561 | 7.45 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
QMSYDEFLEDKTVQDK + 2 Deamidated (NQ) | |
| 873.3969 | 2617.1689 | 2617.2193 | -19.2 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
LYEMFMGPLDASIAWSTTGLDGAR + Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9216 | -12.9 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
NPFIMQVYADVTNMEIK + 3 Deamidated (NQ); Oxidation (M) | |
| 967.9399 | 3867.7304 | 3867.7230 | 1.92 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
AIGIGDASGMFPIDESTQNYNESMVKQFDELISNK + 4 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5554 | -10.3 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
FQAQEREMGK + Deamidated (NQ); Oxidation (M) | |
| 454.7066 | 1814.7972 | 1814.7815 | 8.65 | 0 | 3 | 2 | 1Score > 19 indicates identity |
QLPSDSSEDFMQMLR + 2 Oxidation (M) | |
| 549.2496 | 1096.4846 | 1096.4978 | -12.0 | 0 | 3 | 0.62 | 1Score > 20 indicates identityScore > 13 indicates homology |
YYGYTGAFR | |
| 697.8171 | 1393.6196 | 1393.6282 | -6.19 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
QLNMSVDQLAQK + 4 Deamidated (NQ); Oxidation (M) | |
| 414.1881 | 826.3617 | 826.3709 | -11.0 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
TYQTEGK + Deamidated (NQ) | |
| 616.7802 | 1231.5459 | 1231.5680 | -18.0 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
AEASIQEAEQR + Deamidated (NQ) | |
| 819.3723 | 2455.0951 | 2455.1069 | -4.80 | 0 | 3 | 2.6 | 1Score > 20 indicates identity |
SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 697.8171 | 1393.6196 | 1393.5957 | 17.2 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
SQNSADANISSDGK + Deamidated (NQ) | |
| 792.3600 | 3165.4111 | 3165.4708 | -18.9 | 1 | 3 | 0.78 | 1Score > 20 indicates identityScore > 14 indicates homology |
IEQMKAAFASVAESFQMTWSMNLASELK + 2 Deamidated (NQ); Oxidation (M) | |
| 886.9030 | 3543.5830 | 3543.6470 | -18.1 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ) | |
| 441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
DNNRVGFAEAAR + 2 Deamidated (NQ) | |
| 508.7311 | 2030.8955 | 2030.8970 | -0.75 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
DENGSEQLWPHIFQSSR + 2 Deamidated (NQ) | |
| 603.2741 | 2409.0673 | 2409.0641 | 1.32 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
QAQKTMIQEENQSFLNDHTK + 4 Deamidated (NQ); Oxidation (M) | |
| 967.9399 | 1933.8652 | 1933.8752 | -5.16 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ) | |
| 454.7066 | 907.3986 | 907.4035 | -5.46 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
NDIDFQR + Deamidated (NQ) | |
| 603.2741 | 2409.0673 | 2409.0794 | -5.02 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
SSEFSGQGYMTEALNGLIDFAR + Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 1528.6810 | 1528.7045 | -15.4 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
DDFYQTQNIAVSK + Deamidated (NQ) | |
| 765.3478 | 3057.3620 | 3057.3823 | -6.64 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 454.7066 | 907.3986 | 907.3858 | 14.1 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
NGWVEMR + Deamidated (NQ); Oxidation (M) | |
| 549.2496 | 1644.7269 | 1644.7453 | -11.2 | 0 | 3 | 0.6 | 1Score > 20 indicates identityScore > 13 indicates homology |
EEPADFPQNMLNPK + Oxidation (M) | |
| 724.8293 | 1447.6441 | 1447.6474 | -2.23 | 1 | 3 | 1.6 | 1Score > 17 indicates identity |
NVNDRMNVTDNR + Deamidated (NQ) | |
| 414.1881 | 1652.7235 | 1652.7278 | -2.62 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
RFNTANDDNVTQVR + 4 Deamidated (NQ) | |
| 441.2004 | 880.3863 | 880.4039 | -19.9 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
VEHNQPR + 2 Deamidated (NQ) | |
| 616.7802 | 1231.5459 | 1231.5680 | -18.0 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
AEASIQEAEQR + Deamidated (NQ) | |
| 387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) | |
| 765.3478 | 2293.0215 | 2293.0359 | -6.29 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ) | |
| 454.7066 | 907.3986 | 907.4035 | -5.44 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
EEAADAFR | |
| 481.7188 | 961.4231 | 961.4215 | 1.70 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
TSFNYAMK + Deamidated (NQ) | |
| 562.7557 | 1123.4968 | 1123.5145 | -15.8 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
RYEEVDGQK + Deamidated (NQ) | |
| 738.3355 | 1474.6565 | 1474.6535 | 1.99 | 1 | 3 | 1 | 1Score > 20 indicates identityScore > 15 indicates homology |
NNGNQSPADTAKQK + 3 Deamidated (NQ) | |
| 535.7434 | 2138.9445 | 2138.9217 | 10.7 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
TCCSSLAMAAPEVTNPVCR + Oxidation (M) | |
| 603.2741 | 2409.0673 | 2409.0478 | 8.12 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
TEHHHMAVQEVNDMIQFADR + 2 Deamidated (NQ) | |
| 778.8539 | 3111.3864 | 3111.4019 | -4.98 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
GDMITEQGFEFTINEIDGHHVSYVEVK + 2 Deamidated (NQ); Oxidation (M) | |
| 832.8785 | 3327.4848 | 3327.5123 | -8.25 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
SQVEASAGDTPVQVIDMRDYGTMNGEAVLQK + 3 Deamidated (NQ); Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8618 | -4.70 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
QVNEVMFNLLDSHDTK + 2 Deamidated (NQ); Oxidation (M) | |
| 400.6820 | 1598.6989 | 1598.7114 | -7.78 | 1 | 3 | 1.2 | 1Score > 16 indicates identity |
SWDWYNTGKGATGR + Deamidated (NQ) | |
| 454.7066 | 907.3986 | 907.3957 | 3.23 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
EMNGLAEK + Deamidated (NQ); Oxidation (M) | |
| 778.8539 | 1555.6932 | 1555.7163 | -14.8 | 1 | 3 | 1.9 | 1Score > 18 indicates identity |
YYPHQQGMIMKK + Deamidated (NQ); 2 Oxidation (M) | |
| 414.1881 | 1239.5426 | 1239.5343 | 6.73 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
DVQGAFYHMR + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try
the select summary.