MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 7572)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3088 630.2864 2517.1164 2517.1516 -14.0 1 3 2.3 +1Score > 19 indicates identity SGRQGDPGITQFYLSMEDELMK + Oxidation (M)
5156 792.3600 1582.7055 1582.7045 0.64 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
CQYETLVENNRR + 2 Deamidated (NQ)
1610 508.7311 2030.8955 2030.9142 -9.25 0 3 1.1 +1Score > 16 indicates identity EAGLSDEEALMYAFEAGTK
2409 576.2618 2301.0183 2301.0252 -3.03 1 3 2.3 +1Score > 20 indicates identity NAKTQSLACVASYEAMANNEK + 2 Deamidated (NQ)
1885 535.7434 2138.9445 2138.9765 -14.9 0 3 1.3 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
3610 670.8048 1339.5951 1339.6190 -17.9 1 3 1.8 +1Score > 18 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
6512 900.4092 3597.6076 3597.5857 6.09 1 3 2 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
6582 900.4092 1798.8038 1798.8295 -14.3 1 3 2 +1Score > 19 indicates identity MSKEQLSFLDDVDEK + Oxidation (M)
6631 913.9153 1825.8160 1825.8516 -19.5 1 3 1.8 +1Score > 18 indicates identity MVDQYVRNLNSDLNK + 2 Deamidated (NQ); Oxidation (M)
4023 697.8171 2787.2392 2787.2255 4.93 0 3 1.5 +1Score > 17 indicates identity NMNQAMAYIEEHLTDSIDFQTVAK + 3 Deamidated (NQ); Oxidation (M)
4821 765.3478 3057.3620 3057.4140 -17.0 1 3 2.3 +1Score > 19 indicates identity LIPYDVTIFQTPCFGEDKGYEMVYR + Deamidated (NQ); Oxidation (M)
1657 508.7311 1015.4477 1015.4610 -13.1 0 3 1.1 +1Score > 16 indicates identity EWAQQPEK + Deamidated (NQ)
1753 522.2372 1563.6899 1563.7086 -12.0 1 3 2.2 +1Score > 19 indicates identity LEKNGEMTEDELR + Deamidated (NQ)
1791 522.2372 1042.4599 1042.4753 -14.8 0 3 2.2 +1Score > 19 indicates identity MTDASLSFR + Oxidation (M)
2778 603.2741 1204.5337 1204.5144 16.0 0 3 2.1 +1Score > 19 indicates identity QMFFQDIMK + 2 Deamidated (NQ); Oxidation (M)
1251 481.7188 1922.8463 1922.8801 -17.6 0 3 1.4 +1Score > 17 indicates identity VTILYGTCGQCNCHLK
973 454.7066 907.3986 907.4069 -9.18 0 3 1.9 +1Score > 19 indicates identity MESGETVR
1110 468.2127 1868.8217 1868.8284 -3.59 1 3 2.1 +1Score > 19 indicates identity IDDMRDNEFPIMETK + Oxidation (M)
4777 765.3478 1528.6810 1528.7079 -17.6 0 3 2.3 +1Score > 19 indicates identity FNPDSSLSLMTSSK + Oxidation (M)
620 427.6943 1706.7481 1706.7496 -0.85 0 3 1 +1Score > 16 indicates identity GAAGDNGIYNQDLNER + Deamidated (NQ)
7258 954.4337 2860.2793 2860.3254 -16.1 1 3 2 +1Score > 19 indicates identity NEIYVLCMEEDIMKVVNLLMENK + 2 Deamidated (NQ); 2 Oxidation (M)
1206 481.7188 961.4231 961.4240 -0.88 0 3 1.4 +1Score > 17 indicates identity DELEQAEK + Deamidated (NQ)
1253 481.7188 1922.8463 1922.8680 -11.3 1 3 1.4 +1Score > 17 indicates identity NKDEIGDLGDDFNIMAR + Deamidated (NQ)
2198 549.2496 1096.4846 1096.5011 -15.1 1 3 0.98 +1Score > 20 indicates identity
Score > 16 indicates homology
MKSSYFYR + Oxidation (M)
1860 522.2372 1563.6899 1563.7208 -19.7 0 3 2.2 +1Score > 19 indicates identity MCPVCNGILVQTR + Deamidated (NQ); Oxidation (M)
472 414.1881 1652.7235 1652.7273 -2.35 0 3 2.2 +1Score > 19 indicates identity VDQMMDEGLLDEVK + 2 Oxidation (M)
1185 468.2127 934.4109 934.4066 4.58 0 3 2.1 +1Score > 19 indicates identity DATPEQMK + Oxidation (M)
1405 495.2250 1482.6531 1482.6634 -6.93 1 3 2.1 +1Score > 19 indicates identity QTDSSKQVHHCR + Deamidated (NQ)
1440 495.2250 1976.8708 1976.9084 -19.0 1 3 2.1 +1Score > 19 indicates identity ISPGMSPDAFGKMVEHSR + 2 Oxidation (M)
1629 508.7311 2030.8955 2030.8626 16.2 0 3 1.1 +1Score > 16 indicates identity ASELETAFQTASSNANQMK + 4 Deamidated (NQ)
1064 468.2127 934.4109 934.4290 -19.4 1 3 2.1 +1Score > 19 indicates identity AEGSERMR
2927 616.7802 1231.5459 1231.5469 -0.83 1 3 1.5 +1Score > 17 indicates identity NDRNATWPEK + 2 Deamidated (NQ)
1356 481.7188 961.4231 961.4101 13.6 1 3 1.4 +1Score > 17 indicates identity ERDEEER
367 414.1881 1239.5426 1239.5230 15.8 0 3 2.2 +1Score > 19 indicates identity IYYGNYGSMR + Deamidated (NQ); Oxidation (M)
3440 657.2986 2625.1655 2625.1408 9.40 0 3 2.4 +1Score > 19 indicates identity DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ)
32 387.1759 772.3372 772.3248 16.1 0 3 1.3 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1805 522.2372 2084.9199 2084.9295 -4.63 1 3 2.3 +1Score > 19 indicates identity VFQGKNEQGMAHAAMAYSK + 2 Deamidated (NQ); Oxidation (M)
2314 562.7557 1123.4968 1123.5002 -3.00 0 3 1.6 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
2608 589.7679 1177.5213 1177.5325 -9.47 0 3 1.5 +1Score > 17 indicates identity MNWEQEVLK + 2 Deamidated (NQ)
3485 657.2986 1968.8741 1968.8912 -8.69 0 3 2.4 +1Score > 19 indicates identity QSGLSSDFIELSEATNDR + Deamidated (NQ)
753 441.2004 1320.5795 1320.6058 -19.9 1 3 2.4 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
394 414.1881 1652.7235 1652.7318 -5.07 0 3 2.3 +1Score > 19 indicates identity AGTEGEGGWVDQVYGK + Deamidated (NQ)
3498 657.2986 1312.5827 1312.5856 -2.22 0 3 2.5 +1Score > 19 indicates identity ELNVMTYGEEK + Deamidated (NQ)
4784 765.3478 2293.0215 2293.0359 -6.29 0 3 2.5 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
1914 535.7434 2138.9445 2138.9797 -16.4 1 3 1.4 +1Score > 17 indicates identity TFSTFNVYDTVPNDYKAR + 2 Deamidated (NQ)
2612 589.7679 2355.0427 2355.0762 -14.2 0 3 1.5 +1Score > 17 indicates identity EMQLLHNFALLYAAMDNSEK + 2 Deamidated (NQ); Oxidation (M)
4781 765.3478 2293.0215 2293.0359 -6.29 0 3 2.5 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
1135 468.2127 934.4109 934.4290 -19.4 1 3 2.2 +1Score > 19 indicates identity AEGSERMR
2373 562.7557 2246.9936 2247.0300 -16.2 1 3 1.6 +1Score > 18 indicates identity DAWANLGGHMSVKMTEEEVK + Oxidation (M)
2422 576.2618 1150.5091 1150.5077 1.25 0 3 2.5 +1Score > 20 indicates identity NMGDPLFANR + Deamidated (NQ); Oxidation (M)
4537 738.3355 2949.3129 2949.2565 19.1 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
TFNEDETMLSQSINMLAQNLQDMTR + 4 Deamidated (NQ); Oxidation (M)
4805 765.3478 1528.6810 1528.6688 7.97 1 3 2.5 +1Score > 19 indicates identity VTAGNHCDNLRNR + 3 Deamidated (NQ)
5809 846.3846 3381.5092 3381.4978 3.37 0 3 2.1 +1Score > 19 indicates identity GTPFIYQGEEIGMTNSEMPLEMYDDLEIK + 2 Oxidation (M)
2794 603.2741 2409.0673 2409.0828 -6.41 0 3 2.3 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
656 427.6943 1706.7481 1706.7466 0.88 1 3 1.1 +1Score > 16 indicates identity QYMPMICFSAGNKK + Deamidated (NQ); 2 Oxidation (M)
2231 562.7557 2246.9936 2247.0331 -17.6 1 3 1.6 +1Score > 18 indicates identity QLDSFVDNVNQYKQYQEK + 2 Deamidated (NQ)
1088 468.2127 1401.6163 1401.6268 -7.49 1 3 2.2 +1Score > 19 indicates identity DKAEEMITMYR + Oxidation (M)
1460 495.2250 1976.8708 1976.8561 7.45 1 3 2.2 +1Score > 19 indicates identity QMSYDEFLEDKTVQDK + 2 Deamidated (NQ)
6164 873.3969 2617.1689 2617.2193 -19.2 0 3 2.3 +1Score > 19 indicates identity LYEMFMGPLDASIAWSTTGLDGAR + Oxidation (M)
1641 508.7311 2030.8955 2030.9216 -12.9 0 3 1.2 +1Score > 16 indicates identity NPFIMQVYADVTNMEIK + 3 Deamidated (NQ); Oxidation (M)
7298 967.9399 3867.7304 3867.7230 1.92 1 3 1.3 +1Score > 17 indicates identity AIGIGDASGMFPIDESTQNYNESMVKQFDELISNK + 4 Deamidated (NQ); Oxidation (M)
510 414.1881 1239.5426 1239.5554 -10.3 1 3 2.3 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
932 454.7066 1814.7972 1814.7815 8.65 0 3 2 +1Score > 19 indicates identity QLPSDSSEDFMQMLR + 2 Oxidation (M)
2096 549.2496 1096.4846 1096.4978 -12.0 0 3 0.62 +1Score > 20 indicates identity
Score > 13 indicates homology
YYGYTGAFR
4018 697.8171 1393.6196 1393.6282 -6.19 0 3 1.6 +1Score > 17 indicates identity QLNMSVDQLAQK + 4 Deamidated (NQ); Oxidation (M)
483 414.1881 826.3617 826.3709 -11.0 0 3 2.3 +1Score > 19 indicates identity TYQTEGK + Deamidated (NQ)
2902 616.7802 1231.5459 1231.5680 -18.0 0 3 1.6 +1Score > 17 indicates identity AEASIQEAEQR + Deamidated (NQ)
5562 819.3723 2455.0951 2455.1069 -4.80 0 3 2.6 +1Score > 20 indicates identity SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M)
3928 697.8171 1393.6196 1393.5957 17.2 0 3 1.6 +1Score > 17 indicates identity SQNSADANISSDGK + Deamidated (NQ)
5118 792.3600 3165.4111 3165.4708 -18.9 1 3 0.78 +1Score > 20 indicates identity
Score > 14 indicates homology
IEQMKAAFASVAESFQMTWSMNLASELK + 2 Deamidated (NQ); Oxidation (M)
6298 886.9030 3543.5830 3543.6470 -18.1 1 3 1.5 +1Score > 17 indicates identity SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ)
720 441.2004 1320.5795 1320.6058 -19.9 1 3 2.5 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
1554 508.7311 2030.8955 2030.8970 -0.75 0 3 1.2 +1Score > 16 indicates identity DENGSEQLWPHIFQSSR + 2 Deamidated (NQ)
2849 603.2741 2409.0673 2409.0641 1.32 1 3 2.3 +1Score > 19 indicates identity QAQKTMIQEENQSFLNDHTK + 4 Deamidated (NQ); Oxidation (M)
7299 967.9399 1933.8652 1933.8752 -5.16 1 3 1.4 +1Score > 17 indicates identity NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ)
917 454.7066 907.3986 907.4035 -5.46 0 3 2.1 +1Score > 19 indicates identity NDIDFQR + Deamidated (NQ)
2805 603.2741 2409.0673 2409.0794 -5.02 0 3 2.3 +1Score > 19 indicates identity SSEFSGQGYMTEALNGLIDFAR + Deamidated (NQ); Oxidation (M)
4802 765.3478 1528.6810 1528.7045 -15.4 0 3 2.5 +1Score > 19 indicates identity DDFYQTQNIAVSK + Deamidated (NQ)
4808 765.3478 3057.3620 3057.3823 -6.64 0 3 2.5 +1Score > 19 indicates identity LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M)
913 454.7066 907.3986 907.3858 14.1 0 3 2.1 +1Score > 19 indicates identity NGWVEMR + Deamidated (NQ); Oxidation (M)
2104 549.2496 1644.7269 1644.7453 -11.2 0 3 0.6 +1Score > 20 indicates identity
Score > 13 indicates homology
EEPADFPQNMLNPK + Oxidation (M)
4253 724.8293 1447.6441 1447.6474 -2.23 1 3 1.6 +1Score > 17 indicates identity NVNDRMNVTDNR + Deamidated (NQ)
393 414.1881 1652.7235 1652.7278 -2.62 1 3 2.4 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
830 441.2004 880.3863 880.4039 -19.9 0 3 2.5 +1Score > 19 indicates identity VEHNQPR + 2 Deamidated (NQ)
2906 616.7802 1231.5459 1231.5680 -18.0 0 3 1.6 +1Score > 17 indicates identity AEASIQEAEQR + Deamidated (NQ)
44 387.1759 772.3372 772.3248 16.1 0 3 1.4 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
4846 765.3478 2293.0215 2293.0359 -6.29 0 3 2.6 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
1006 454.7066 907.3986 907.4035 -5.44 0 3 2.1 +1Score > 19 indicates identity EEAADAFR
1349 481.7188 961.4231 961.4215 1.70 0 3 1.5 +1Score > 17 indicates identity TSFNYAMK + Deamidated (NQ)
2270 562.7557 1123.4968 1123.5145 -15.8 1 3 1.7 +1Score > 18 indicates identity RYEEVDGQK + Deamidated (NQ)
4454 738.3355 1474.6565 1474.6535 1.99 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
NNGNQSPADTAKQK + 3 Deamidated (NQ)
1930 535.7434 2138.9445 2138.9217 10.7 0 3 1.4 +1Score > 17 indicates identity TCCSSLAMAAPEVTNPVCR + Oxidation (M)
2770 603.2741 2409.0673 2409.0478 8.12 0 3 2.4 +1Score > 19 indicates identity TEHHHMAVQEVNDMIQFADR + 2 Deamidated (NQ)
5034 778.8539 3111.3864 3111.4019 -4.98 0 3 1.9 +1Score > 18 indicates identity GDMITEQGFEFTINEIDGHHVSYVEVK + 2 Deamidated (NQ); Oxidation (M)
5634 832.8785 3327.4848 3327.5123 -8.25 1 3 1.5 +1Score > 17 indicates identity SQVEASAGDTPVQVIDMRDYGTMNGEAVLQK + 3 Deamidated (NQ); Oxidation (M)
7175 954.4337 1906.8529 1906.8618 -4.70 0 3 2.2 +1Score > 19 indicates identity QVNEVMFNLLDSHDTK + 2 Deamidated (NQ); Oxidation (M)
324 400.6820 1598.6989 1598.7114 -7.78 1 3 1.2 +1Score > 16 indicates identity SWDWYNTGKGATGR + Deamidated (NQ)
915 454.7066 907.3986 907.3957 3.23 0 3 2.1 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
5037 778.8539 1555.6932 1555.7163 -14.8 1 3 1.9 +1Score > 18 indicates identity YYPHQQGMIMKK + Deamidated (NQ); 2 Oxidation (M)
359 414.1881 1239.5426 1239.5343 6.73 0 3 2.4 +1Score > 19 indicates identity DVQGAFYHMR + Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  76 Next 

Not what you expected? Try the select summary.