MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues) |
| Timestamp | : | 4 Dec 2025 at 15:32:34 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2209 |
549.2496 | 1644.7269 | 1644.6977 | 17.7 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
GMNWSVEAEYNSLK + 2 Deamidated (NQ); Oxidation (M) |
| 6149 |
873.3969 | 2617.1689 | 2617.1604 | 3.26 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
ELGYSAMALTDDEVMYGAVEFYK + Oxidation (M) |
| 1970 |
535.7434 | 1069.4723 | 1069.4750 | -2.55 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
MDQFKQEK + Deamidated (NQ); Oxidation (M) |
| 2100 |
549.2496 | 1096.4846 | 1096.4978 | -12.0 | 0 | 4 | 0.58 | 1Score > 20 indicates identity Score > 14 indicates homology |
YYGYTGAFR |
| 3700 |
670.8048 | 1339.5951 | 1339.6190 | -17.9 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
KDSGFQMNQLR + Deamidated (NQ); Oxidation (M) |
| 2257 |
562.7557 | 2246.9936 | 2247.0100 | -7.28 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
IGNLQAEDEVIEMNQVEANK + 4 Deamidated (NQ) |
| 3824 |
684.3109 | 2733.2145 | 2733.2625 | -17.6 | 1 | 4 | 2 | 1Score > 19 indicates identity |
LSQPDMMNFEEHIRDNISDVITK + 2 Deamidated (NQ) |
| 477 |
414.1881 | 1239.5426 | 1239.5554 | -10.3 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
FQAQEREMGK + Deamidated (NQ); Oxidation (M) |
| 976 |
454.7066 | 907.3986 | 907.3923 | 6.95 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
NPQYQEK + 2 Deamidated (NQ) |
| 637 |
427.6943 | 853.3741 | 853.3786 | -5.31 | 1 | 4 | 0.89 | 1Score > 16 indicates identity |
QMMKQR + Deamidated (NQ); 2 Oxidation (M) |
| 2688 |
589.7679 | 1177.5213 | 1177.5211 | 0.21 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
DSESVDKENR |
| 6211 |
873.3969 | 2617.1689 | 2617.1467 | 8.49 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
VNQLSGSIQMAQMMLQMFHAMR + 2 Deamidated (NQ); 4 Oxidation (M) |
| 1058 |
468.2127 | 934.4109 | 934.4290 | -19.4 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
AEGSERMR |
| 283 |
400.6820 | 1598.6989 | 1598.6812 | 11.1 | 0 | 4 | 0.92 | 1Score > 16 indicates identity |
MLMQVMQDPEMAK + 3 Oxidation (M) |
| 3097 |
630.2864 | 1887.8373 | 1887.8639 | -14.1 | 0 | 4 | 2 | 1Score > 19 indicates identity |
QFQEVEAVTFQYNQR + 2 Deamidated (NQ) |
| 6157 |
873.3969 | 2617.1689 | 2617.1467 | 8.49 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
VNQLSGSIQMAQMMLQMFHAMR + 2 Deamidated (NQ); 4 Oxidation (M) |
| 2084 |
549.2496 | 2192.9692 | 2192.9792 | -4.57 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M) |
| 2201 |
549.2496 | 1644.7269 | 1644.6977 | 17.7 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
GMNWSVEAEYNSLK + 2 Deamidated (NQ); Oxidation (M) |
| 3784 |
684.3109 | 2733.2145 | 2733.2084 | 2.24 | 1 | 4 | 2 | 1Score > 19 indicates identity |
MQDIIYCEGANRFPGVDTEQVMK + Deamidated (NQ); 2 Oxidation (M) |
| 4807 |
765.3478 | 3057.3620 | 3057.3956 | -11.0 | 0 | 4 | 2.1 | 1Score > 19 indicates identity |
GFVTDVIENEGLQFDCIMACGPTPMLK + Oxidation (M) |
| 816 |
441.2004 | 1320.5795 | 1320.5980 | -14.0 | 0 | 4 | 2 | 1Score > 19 indicates identity |
GECLGLAGESGSGK |
| 1589 |
508.7311 | 2030.8955 | 2030.9288 | -16.4 | 1 | 4 | 0.99 | 1Score > 16 indicates identity |
NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M) |
| 3761 |
684.3109 | 2049.9109 | 2049.9313 | -9.96 | 1 | 4 | 2 | 1Score > 19 indicates identity |
QGEYQKPEPPDSGDMKTK + Oxidation (M) |
| 74 |
387.1759 | 1544.6744 | 1544.6673 | 4.60 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
EQMMYDMEALLR + Oxidation (M) |
| 7425 |
967.9399 | 1933.8652 | 1933.8752 | -5.16 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ) |
| 6130 |
873.3969 | 2617.1689 | 2617.1467 | 8.49 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
VNQLSGSIQMAQMMLQMFHAMR + 2 Deamidated (NQ); 4 Oxidation (M) |
| 5624 |
832.8785 | 1663.7424 | 1663.7624 | -12.0 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
NRMNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M) |
| 1797 |
522.2372 | 1563.6899 | 1563.7086 | -12.0 | 1 | 4 | 2 | 1Score > 19 indicates identity |
LEKNGEMTEDELR + Deamidated (NQ) |
| 2173 |
549.2496 | 1644.7269 | 1644.7406 | -8.35 | 0 | 4 | 0.55 | 1Score > 20 indicates identity Score > 14 indicates homology |
QYETFEDQLQTLK + 3 Deamidated (NQ) |
| 2796 |
603.2741 | 1204.5337 | 1204.5459 | -10.2 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
EAGLLDDQSEK + Deamidated (NQ) |
| 6158 |
873.3969 | 3489.5585 | 3489.6122 | -15.4 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
AYPVQGSDCSPFCSLAFFRPDIYHEIKQR + 2 Deamidated (NQ) |
| 7188 |
954.4337 | 2860.2793 | 2860.3185 | -13.7 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
SQQSSDPDPNCVDRPVEGYLAVAVVR + 3 Deamidated (NQ) |
| 390 |
414.1881 | 1652.7235 | 1652.7278 | -2.62 | 1 | 4 | 2 | 1Score > 19 indicates identity |
RFNTANDDNVTQVR + 4 Deamidated (NQ) |
| 2271 |
562.7557 | 2246.9936 | 2246.9662 | 12.2 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
NLPENGSSSQSGGGEEEAAPLSK + 3 Deamidated (NQ) |
| 4207 |
711.3232 | 1420.6319 | 1420.6218 | 7.10 | 1 | 4 | 2.1 | 1Score > 19 indicates identity |
EPENQQAFRGSR + 3 Deamidated (NQ) |
| 80 |
387.1759 | 1544.6744 | 1544.6824 | -5.17 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
CQHCQKNEATIR + Deamidated (NQ) |
| 2310 |
562.7557 | 1123.4968 | 1123.4903 | 5.83 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
GNMNWMKAR + Deamidated (NQ); Oxidation (M) |
| 5463 |
819.3723 | 1636.7301 | 1636.7515 | -13.1 | 1 | 4 | 2.2 | 1Score > 20 indicates identity |
GIAENDAFLKDECR |
| 5798 |
846.3846 | 2536.1319 | 2536.1018 | 11.9 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
QMAQSLEQMNVINHVMEASVEK + 5 Deamidated (NQ); Oxidation (M) |
| 1645 |
508.7311 | 1015.4477 | 1015.4393 | 8.34 | 1 | 4 | 1 | 1Score > 16 indicates identity |
NNSSKMYR + Deamidated (NQ); Oxidation (M) |
| 2020 |
535.7434 | 2138.9445 | 2138.9758 | -14.6 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M) |
| 3250 |
643.7925 | 2571.1411 | 2571.1812 | -15.6 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
QIPGSFIPMQFDNEANPEAHRR + 2 Deamidated (NQ); Oxidation (M) |
| 2441 |
576.2618 | 1150.5091 | 1150.5077 | 1.25 | 0 | 4 | 2.2 | 1Score > 20 indicates identity |
NMGDPLFANR + Deamidated (NQ); Oxidation (M) |
| 310 |
400.6820 | 799.3495 | 799.3422 | 9.09 | 0 | 4 | 0.96 | 1Score > 16 indicates identity |
FTMEEK + Oxidation (M) |
| 363 |
414.1881 | 1652.7235 | 1652.7273 | -2.31 | 0 | 4 | 2 | 1Score > 19 indicates identity |
SQLMQCAQLINQAK + 5 Deamidated (NQ); Oxidation (M) |
| 647 |
427.6943 | 1706.7481 | 1706.7675 | -11.4 | 0 | 4 | 0.94 | 1Score > 16 indicates identity |
DGQYSLSYVDFINGK + 2 Deamidated (NQ) |
| 5461 |
819.3723 | 2455.0951 | 2455.1181 | -9.38 | 1 | 4 | 2.2 | 1Score > 20 indicates identity |
ETALNEVMDMLRMFGLPADDR + 2 Oxidation (M) |
| 403 |
414.1881 | 826.3617 | 826.3643 | -3.15 | 0 | 4 | 2 | 1Score > 19 indicates identity |
MYVDGAR + Oxidation (M) |
| 2238 |
562.7557 | 1123.4968 | 1123.5179 | -18.8 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
SIQTMEDRK + Deamidated (NQ); Oxidation (M) |
| 1052 |
468.2127 | 934.4109 | 934.4290 | -19.4 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
AEGSERMR |
| 1167 |
468.2127 | 934.4109 | 934.3967 | 15.2 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
NWEMAER |
| 4930 |
778.8539 | 1555.6932 | 1555.6936 | -0.28 | 1 | 4 | 1.6 | 1Score > 18 indicates identity |
SFMQEREETGASGK |
| 1925 |
535.7434 | 1069.4723 | 1069.4750 | -2.55 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
MDQFKQEK + Deamidated (NQ); Oxidation (M) |
| 4776 |
765.3478 | 2293.0215 | 2292.9952 | 11.5 | 0 | 4 | 2.2 | 1Score > 19 indicates identity |
FALMNMDGMTYEELDLSGEK |
| 1399 |
495.2250 | 1482.6531 | 1482.6634 | -6.93 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
QTDSSKQVHHCR + Deamidated (NQ) |
| 5966 |
859.8907 | 3435.5339 | 3435.5223 | 3.37 | 1 | 4 | 1.1 | 1Score > 16 indicates identity |
QWEDFAHELCHVLKHAGNQLYMNQMFR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 6565 |
900.4092 | 1798.8038 | 1798.7978 | 3.36 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
AEEAARFMNGMAEALR + Deamidated (NQ); 2 Oxidation (M) |
| 2260 |
562.7557 | 1123.4968 | 1123.5145 | -15.8 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
RYEEVDGQK + Deamidated (NQ) |
| 2418 |
576.2618 | 2301.0183 | 2301.0623 | -19.1 | 0 | 4 | 2.2 | 1Score > 20 indicates identity |
SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ) |
| 1903 |
535.7434 | 2138.9445 | 2138.9758 | -14.6 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M) |
| 5138 |
792.3600 | 1582.7055 | 1582.7151 | -6.03 | 0 | 4 | 0.73 | 1Score > 20 indicates identity Score > 15 indicates homology |
ADEKPPYTYADGEK |
| 337 |
400.6820 | 1598.6989 | 1598.6738 | 15.7 | 0 | 3 | 0.98 | 1Score > 16 indicates identity |
TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M) |
| 1008 |
454.7066 | 907.3986 | 907.4069 | -9.16 | 1 | 3 | 1.8 | 1Score > 19 indicates identity |
MVKENDR + Deamidated (NQ); Oxidation (M) |
| 1438 |
495.2250 | 1482.6531 | 1482.6330 | 13.6 | 1 | 3 | 1.9 | 1Score > 19 indicates identity |
MDQNQQKLTAMR + 4 Deamidated (NQ); Oxidation (M) |
| 56 |
387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) |
| 52 |
387.1759 | 1544.6744 | 1544.6824 | -5.17 | 1 | 3 | 1.2 | 1Score > 17 indicates identity |
CQHCQKNEATIR + Deamidated (NQ) |
| 1901 |
535.7434 | 2138.9445 | 2138.9758 | -14.6 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M) |
| 2078 |
549.2496 | 1096.4846 | 1096.4978 | -12.0 | 0 | 3 | 0.84 | 1Score > 20 indicates identity Score > 15 indicates homology |
YYGYTGAFR |
| 28 |
387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) |
| 3919 |
697.8171 | 1393.6196 | 1393.5957 | 17.2 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
SQNSADANISSDGK + Deamidated (NQ) |
| 465 |
414.1881 | 1239.5426 | 1239.5368 | 4.70 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
TDVTDFSDNAR |
| 4067 |
697.8171 | 2787.2392 | 2787.2163 | 8.22 | 1 | 3 | 1.4 | 1Score > 17 indicates identity |
HIDYNGRLCMSAAATAANQTFGMDR + Deamidated (NQ); Oxidation (M) |
| 409 |
414.1881 | 1652.7235 | 1652.7273 | -2.31 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
SQLMQCAQLINQAK + 5 Deamidated (NQ); Oxidation (M) |
| 3082 |
630.2864 | 2517.1164 | 2517.1183 | -0.74 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
IEKAFQHGEEWEINGDENQIK + 4 Deamidated (NQ) |
| 5337 |
805.8662 | 1609.7179 | 1609.7471 | -18.1 | 1 | 3 | 1.8 | 1Score > 19 indicates identity |
AIYNNEVSQKGEEK + 2 Deamidated (NQ) |
| 34 |
387.1759 | 1544.6744 | 1544.7003 | -16.8 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
GSVPFNVMMFASDK + Oxidation (M) |
| 5682 |
832.8785 | 3327.4848 | 3327.4561 | 8.63 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
GHNNVQGACDMGTLPGWLPGYQHITDDKAR + 4 Deamidated (NQ); Oxidation (M) |
| 2440 |
576.2618 | 2301.0183 | 2301.0623 | -19.1 | 0 | 3 | 2.3 | 1Score > 20 indicates identity |
SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ) |
| 3763 |
684.3109 | 1366.6073 | 1366.6034 | 2.83 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
MANQQSKTNAQK + 3 Deamidated (NQ); Oxidation (M) |
| 5506 |
819.3723 | 1636.7301 | 1636.7515 | -13.1 | 1 | 3 | 2.3 | 1Score > 20 indicates identity |
QNRNLAFTPENGMK + 2 Deamidated (NQ); Oxidation (M) |
| 104 |
387.1759 | 772.3372 | 772.3286 | 11.1 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
MNHESR |
| 1496 |
495.2250 | 1482.6531 | 1482.6409 | 8.25 | 0 | 3 | 2 | 1Score > 19 indicates identity |
NDNHSPAPQMINK + 2 Deamidated (NQ); Oxidation (M) |
| 1771 |
522.2372 | 1042.4599 | 1042.4753 | -14.8 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
MTDASLSFR + Oxidation (M) |
| 2481 |
576.2618 | 1150.5091 | 1150.5176 | -7.34 | 0 | 3 | 2.3 | 1Score > 20 indicates identity |
GQATDMEISAK + Deamidated (NQ) |
| 1242 |
481.7188 | 961.4231 | 961.4352 | -12.6 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
DAGDQKAEK + Deamidated (NQ) |
| 1760 |
522.2372 | 1563.6899 | 1563.6987 | -5.63 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
MNHENREQYTLK + 2 Deamidated (NQ) |
| 100 |
387.1759 | 772.3372 | 772.3351 | 2.67 | 0 | 3 | 1.2 | 1Score > 17 indicates identity |
DPDQAAR + Deamidated (NQ) |
| 1639 |
508.7311 | 2030.8955 | 2030.8626 | 16.2 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
ASELETAFQTASSNANQMK + 4 Deamidated (NQ) |
| 2431 |
576.2618 | 1150.5091 | 1150.5254 | -14.2 | 0 | 3 | 2.3 | 1Score > 20 indicates identity |
AYLAAADGDER |
| 2539 |
576.2618 | 1725.7637 | 1725.7879 | -14.1 | 0 | 3 | 2.3 | 1Score > 20 indicates identity |
GELQCIGATTLDEYR + Deamidated (NQ) |
| 3889 |
684.3109 | 2733.2145 | 2733.2399 | -9.26 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
CQNSKLEAAVTQAEQQGEVALNDAR + 4 Deamidated (NQ) |
| 463 |
414.1881 | 826.3617 | 826.3709 | -11.0 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
TYQTEGK + Deamidated (NQ) |
| 761 |
441.2004 | 1320.5795 | 1320.6045 | -18.9 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
TDAADETVSGIDK |
| 1072 |
468.2127 | 934.4109 | 934.4290 | -19.4 | 1 | 3 | 2 | 1Score > 19 indicates identity |
AEGSERMR |
| 2416 |
576.2618 | 1725.7637 | 1725.7590 | 2.75 | 0 | 3 | 2.3 | 1Score > 20 indicates identity |
MSFDPNNVLMQDAVK + 2 Deamidated (NQ); Oxidation (M) |
| 154 |
387.1759 | 1544.6744 | 1544.6824 | -5.17 | 1 | 3 | 1.2 | 1Score > 17 indicates identity |
CQHCQKNEATIR + Deamidated (NQ) |
| 3170 |
630.2864 | 1887.8373 | 1887.8374 | -0.044 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
SGQLQYEETITEGFER + 2 Deamidated (NQ) |
| 577 |
427.6943 | 853.3741 | 853.3786 | -5.31 | 1 | 3 | 1 | 1Score > 16 indicates identity |
QMMKQR + Deamidated (NQ); 2 Oxidation (M) |
| 2075 |
549.2496 | 1096.4846 | 1096.4754 | 8.42 | 1 | 3 | 0.95 | 1Score > 20 indicates identity Score > 16 indicates homology |
CMRSLDGSR + Oxidation (M) |
| 5961 |
859.8907 | 3435.5339 | 3435.5223 | 3.37 | 1 | 3 | 1.1 | 1Score > 16 indicates identity |
QWEDFAHELCHVLKHAGNQLYMNQMFR + 2 Deamidated (NQ); 2 Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/