MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues) |
| Timestamp | : | 4 Dec 2025 at 15:32:34 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 872 |
454.7066 | 907.3986 | 907.3957 | 3.23 | 0 | 5 | 1.3 | 1Score > 19 indicates identity |
EMNGLAEK + Deamidated (NQ); Oxidation (M) |
| 2442 |
576.2618 | 2301.0183 | 2301.0583 | -17.4 | 1 | 5 | 1.7 | 1Score > 20 indicates identity |
DKPMPEDGYHGEDIKEIGQK + Oxidation (M) |
| 6528 |
900.4092 | 3597.6076 | 3597.5518 | 15.5 | 0 | 5 | 1.4 | 1Score > 19 indicates identity |
ELTQPSMFSGNHFFGGGGSFFSQPSQAQTQTAAK + 5 Deamidated (NQ); Oxidation (M) |
| 426 |
414.1881 | 1239.5426 | 1239.5554 | -10.3 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
QMAEGRSADFK + Deamidated (NQ) |
| 5110 |
792.3600 | 2374.0583 | 2374.0821 | -10.0 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M) |
| 6696 |
913.9153 | 1825.8160 | 1825.8105 | 3.02 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
GQYILEGEISTETEQQ + 2 Deamidated (NQ) |
| 3510 |
657.2986 | 1968.8741 | 1968.9099 | -18.2 | 0 | 5 | 1.7 | 1Score > 19 indicates identity |
DYSDNLDAMLLTALSGDR |
| 5402 |
805.8662 | 1609.7179 | 1609.7215 | -2.24 | 0 | 5 | 1.4 | 1Score > 19 indicates identity |
MVLDVIMSNEAENK + 2 Deamidated (NQ); Oxidation (M) |
| 600 |
427.6943 | 853.3741 | 853.3673 | 7.87 | 1 | 5 | 0.74 | 1Score > 16 indicates identity |
NMADMKK + Deamidated (NQ); Oxidation (M) |
| 1607 |
508.7311 | 2030.8955 | 2030.9142 | -9.25 | 0 | 5 | 0.8 | 1Score > 16 indicates identity |
EAGLSDEEALMYAFEAGTK |
| 272 |
400.6820 | 799.3495 | 799.3646 | -19.0 | 0 | 5 | 0.75 | 1Score > 16 indicates identity |
MEHINR + Deamidated (NQ) |
| 1450 |
495.2250 | 1976.8708 | 1976.9010 | -15.3 | 0 | 5 | 1.5 | 1Score > 19 indicates identity |
GAMLTHQNLFSNANDTAR + Deamidated (NQ); Oxidation (M) |
| 1714 |
522.2372 | 1563.6899 | 1563.6736 | 10.4 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
MVANEEDGWRNAR + Deamidated (NQ); Oxidation (M) |
| 2061 |
549.2496 | 1096.4846 | 1096.4785 | 5.56 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
YTNATDADAR |
| 1215 |
481.7188 | 961.4231 | 961.4361 | -13.5 | 0 | 5 | 1 | 1Score > 17 indicates identity |
MAAAGGEPMK |
| 6952 |
940.9276 | 1879.8405 | 1879.8370 | 1.89 | 0 | 5 | 0.97 | 1Score > 17 indicates identity |
AGAGPHIMQLEPEEDNR + Deamidated (NQ); Oxidation (M) |
| 611 |
427.6943 | 853.3741 | 853.3786 | -5.31 | 1 | 5 | 0.74 | 1Score > 16 indicates identity |
QMMKQR + Deamidated (NQ); 2 Oxidation (M) |
| 439 |
414.1881 | 1652.7235 | 1652.7278 | -2.62 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
RFNTANDDNVTQVR + 4 Deamidated (NQ) |
| 4355 |
724.8293 | 1447.6441 | 1447.6474 | -2.23 | 1 | 5 | 1 | 1Score > 17 indicates identity |
NVNDRMNVTDNR + Deamidated (NQ) |
| 386 |
414.1881 | 826.3617 | 826.3709 | -11.1 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
FQTTDSK + Deamidated (NQ) |
| 431 |
414.1881 | 1239.5426 | 1239.5484 | -4.65 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
AMMMVQLMER + Deamidated (NQ) |
| 2082 |
549.2496 | 2192.9692 | 2192.9419 | 12.4 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MNQEINIQNALVNDDEWK + 4 Deamidated (NQ); Oxidation (M) |
| 1105 |
468.2127 | 934.4109 | 934.4145 | -3.85 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
TGEPFDNR |
| 31 |
387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 4 | 0.93 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) |
| 1328 |
481.7188 | 961.4231 | 961.4101 | 13.6 | 0 | 4 | 1 | 1Score > 17 indicates identity |
NGATNVNNR + 3 Deamidated (NQ) |
| 3105 |
630.2864 | 1258.5582 | 1258.5830 | -19.7 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
DQFLEQHDVK + Deamidated (NQ) |
| 6489 |
900.4092 | 2698.2057 | 2698.1884 | 6.41 | 1 | 4 | 1.5 | 1Score > 19 indicates identity |
CVEADCGQMQEELDLTISAETRK + Oxidation (M) |
| 1563 |
508.7311 | 2030.8955 | 2030.8891 | 3.12 | 0 | 4 | 0.84 | 1Score > 16 indicates identity |
DEFGQLGTSFNEMAESLR + Deamidated (NQ) |
| 3536 |
657.2986 | 1968.8741 | 1968.9099 | -18.2 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
DYSDNLDAMLLTALSGDR |
| 222 |
400.6820 | 799.3495 | 799.3646 | -19.0 | 0 | 4 | 0.79 | 1Score > 16 indicates identity |
MEHINR + Deamidated (NQ) |
| 7187 |
954.4337 | 2860.2793 | 2860.3292 | -17.5 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
DMIVILNDNEMSIAPNVGAIHSMLGR + 3 Deamidated (NQ); 3 Oxidation (M) |
| 200 |
400.6820 | 1598.6989 | 1598.7261 | -17.0 | 0 | 4 | 0.8 | 1Score > 16 indicates identity |
MHFMELFPYEQK |
| 392 |
414.1881 | 1239.5426 | 1239.5549 | -9.93 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
MLEVVDEMMK + Oxidation (M) |
| 999 |
454.7066 | 1814.7972 | 1814.8033 | -3.34 | 0 | 4 | 1.4 | 1Score > 19 indicates identity |
GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M) |
| 532 |
427.6943 | 853.3741 | 853.3792 | -6.07 | 0 | 4 | 0.78 | 1Score > 16 indicates identity |
HEYMFK |
| 548 |
427.6943 | 853.3741 | 853.3818 | -9.03 | 0 | 4 | 0.78 | 1Score > 16 indicates identity |
QFSQTDK + Deamidated (NQ) |
| 1608 |
508.7311 | 2030.8955 | 2030.9111 | -7.73 | 0 | 4 | 0.86 | 1Score > 16 indicates identity |
ISSGSFQTDGMIVAPCSMK + Oxidation (M) |
| 900 |
454.7066 | 907.3986 | 907.4147 | -17.8 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
NAAYENAR |
| 2521 |
576.2618 | 1725.7637 | 1725.7735 | -5.71 | 1 | 4 | 1.8 | 1Score > 20 indicates identity |
MLSKDMQNVLDEMR + Deamidated (NQ); Oxidation (M) |
| 5107 |
792.3600 | 2374.0583 | 2374.0821 | -10.0 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M) |
| 3596 |
670.8048 | 1339.5951 | 1339.6118 | -12.5 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
DCELPFFIDGK |
| 303 |
400.6820 | 799.3495 | 799.3646 | -19.0 | 0 | 4 | 0.81 | 1Score > 16 indicates identity |
MEHINR + Deamidated (NQ) |
| 460 |
414.1881 | 826.3617 | 826.3709 | -11.1 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
YTDVSDK |
| 5130 |
792.3600 | 1582.7055 | 1582.7330 | -17.4 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MNEKSAASEMLQTK + Oxidation (M) |
| 491 |
414.1881 | 826.3617 | 826.3643 | -3.15 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
MYVDGAR + Oxidation (M) |
| 1741 |
522.2372 | 1563.6899 | 1563.7086 | -12.0 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
LEKNGEMTEDELR + Deamidated (NQ) |
| 4783 |
765.3478 | 2293.0215 | 2293.0355 | -6.09 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
QIPEADIVNPDNCGMSTLFR + Deamidated (NQ); Oxidation (M) |
| 77 |
387.1759 | 1544.6744 | 1544.6824 | -5.17 | 1 | 4 | 0.96 | 1Score > 17 indicates identity |
CQHCQKNEATIR + Deamidated (NQ) |
| 4360 |
724.8293 | 1447.6441 | 1447.6620 | -12.3 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
GDFQYTFEGKEK |
| 1096 |
468.2127 | 1868.8217 | 1868.8462 | -13.1 | 1 | 4 | 1.6 | 1Score > 19 indicates identity |
FEMLDNIETKEGAQAR + 2 Deamidated (NQ); Oxidation (M) |
| 772 |
441.2004 | 1320.5795 | 1320.6045 | -18.9 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
TDAADETVSGIDK |
| 2123 |
549.2496 | 1096.4846 | 1096.4785 | 5.56 | 0 | 4 | 0.46 | 1Score > 20 indicates identity Score > 13 indicates homology |
YTNATDADAR |
| 3766 |
684.3109 | 1366.6073 | 1366.6075 | -0.13 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
EAVEQGMPAYQK + Deamidated (NQ); Oxidation (M) |
| 2066 |
549.2496 | 2192.9692 | 2192.9432 | 11.8 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
SENAYNSMYKTLANHNYR + 2 Deamidated (NQ); Oxidation (M) |
| 133 |
387.1759 | 1544.6744 | 1544.7003 | -16.8 | 0 | 4 | 0.97 | 1Score > 17 indicates identity |
GSVPFNVMMFASDK + Oxidation (M) |
| 2524 |
576.2618 | 1150.5091 | 1150.5255 | -14.2 | 0 | 4 | 1.9 | 1Score > 20 indicates identity |
FSQLNQNDGK + Deamidated (NQ) |
| 366 |
414.1881 | 826.3617 | 826.3564 | 6.40 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
MKMEEK + 2 Oxidation (M) |
| 4934 |
778.8539 | 3111.3864 | 3111.3592 | 8.75 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
TSPIAWDMNCLEEVCGACSMVINGKPR + Deamidated (NQ); Oxidation (M) |
| 7196 |
954.4337 | 2860.2793 | 2860.3292 | -17.5 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
DMIVILNDNEMSIAPNVGAIHSMLGR + 3 Deamidated (NQ); 3 Oxidation (M) |
| 2791 |
603.2741 | 2409.0673 | 2409.0828 | -6.41 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M) |
| 4021 |
697.8171 | 1393.6196 | 1393.6184 | 0.89 | 0 | 4 | 1.2 | 1Score > 17 indicates identity |
MNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M) |
| 5655 |
832.8785 | 1663.7424 | 1663.7698 | -16.4 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
LLNFMSEHMTANEK |
| 6290 |
886.9030 | 3543.5830 | 3543.6470 | -18.1 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ) |
| 1426 |
495.2250 | 1976.8708 | 1976.8859 | -7.65 | 1 | 4 | 1.6 | 1Score > 19 indicates identity |
LYEEKMTDYPAMALDR + 2 Oxidation (M) |
| 1481 |
495.2250 | 1482.6531 | 1482.6362 | 11.4 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
QVETFVSNNEADK + 3 Deamidated (NQ) |
| 45 |
387.1759 | 1544.6744 | 1544.7003 | -16.8 | 0 | 4 | 0.99 | 1Score > 17 indicates identity |
GSVPFNVMMFASDK + Oxidation (M) |
| 751 |
441.2004 | 1760.7727 | 1760.8039 | -17.8 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
NEQPPENSSMFKQPK + Deamidated (NQ) |
| 374 |
414.1881 | 826.3617 | 826.3709 | -11.1 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
YTDVSDK |
| 958 |
454.7066 | 1814.7972 | 1814.8033 | -3.34 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M) |
| 1130 |
468.2127 | 934.4109 | 934.4144 | -3.83 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
AAESDWTR |
| 5080 |
778.8539 | 3111.3864 | 3111.4481 | -19.8 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
EYMITAEGQKALQSWLEEPINDIASEK + 3 Deamidated (NQ); Oxidation (M) |
| 382 |
414.1881 | 1239.5426 | 1239.5619 | -15.6 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
YITNTQDEEK |
| 836 |
441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
DNNRVGFAEAAR + 2 Deamidated (NQ) |
| 6365 |
886.9030 | 1771.7915 | 1771.8120 | -11.6 | 1 | 4 | 1.1 | 1Score > 17 indicates identity |
NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M) |
| 2141 |
549.2496 | 1644.7269 | 1644.7487 | -13.3 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSATVAGMAINFTGNK + Deamidated (NQ); 2 Oxidation (M) |
| 2866 |
603.2741 | 1204.5337 | 1204.5459 | -10.2 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
EAGLLDDQSEK + Deamidated (NQ) |
| 5656 |
832.8785 | 1663.7424 | 1663.7723 | -18.0 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
TADGQVVTAEQMLER + Deamidated (NQ); Oxidation (M) |
| 5810 |
846.3846 | 1690.7546 | 1690.7534 | 0.74 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
DDTAVTDEDVQNELK |
| 3688 |
670.8048 | 1339.5951 | 1339.6078 | -9.52 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
DRVDYMDVSPK + Oxidation (M) |
| 6708 |
913.9153 | 1825.8160 | 1825.8152 | 0.44 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
QDGSLDYMGRADQQIK + 2 Deamidated (NQ) |
| 2035 |
535.7434 | 1069.4723 | 1069.4750 | -2.55 | 1 | 4 | 1 | 1Score > 17 indicates identity |
MDQFKQEK + Deamidated (NQ); Oxidation (M) |
| 156 |
387.1759 | 1158.5058 | 1158.5162 | -8.95 | 1 | 4 | 1 | 1Score > 17 indicates identity |
YCLRMTGDK + Oxidation (M) |
| 157 |
387.1759 | 1158.5058 | 1158.5265 | -17.9 | 0 | 4 | 1 | 1Score > 17 indicates identity |
QQLDAANQNR + 2 Deamidated (NQ) |
| 3129 |
630.2864 | 1258.5582 | 1258.5396 | 14.8 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
GMMEFQEMLK + Oxidation (M) |
| 5076 |
778.8539 | 1555.6932 | 1555.7168 | -15.2 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
GWGPYSRSSFDAAR |
| 5458 |
819.3723 | 2455.0951 | 2455.1002 | -2.06 | 0 | 4 | 2 | 1Score > 20 indicates identity |
NVFMFLEPGESPNYPEGIQDR + Deamidated (NQ); Oxidation (M) |
| 899 |
454.7066 | 907.3986 | 907.4035 | -5.46 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
NDIDFQR + Deamidated (NQ) |
| 3492 |
657.2986 | 1968.8741 | 1968.8748 | -0.37 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
GVDCSQFSPAHQTEHIR + Deamidated (NQ) |
| 4179 |
711.3232 | 2130.9479 | 2130.9602 | -5.75 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
MGGQYIFSSVPIMNAEQNK + 2 Deamidated (NQ); Oxidation (M) |
| 5106 |
792.3600 | 2374.0583 | 2374.0821 | -10.0 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M) |
| 2786 |
603.2741 | 1806.8005 | 1806.8015 | -0.57 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
TLDMIANAAQPSPGMEK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 76 |
387.1759 | 1158.5058 | 1158.5193 | -11.7 | 0 | 4 | 1 | 1Score > 17 indicates identity |
GELPEGWDQK + Deamidated (NQ) |
| 699 |
441.2004 | 1760.7727 | 1760.8006 | -15.9 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
SVNPPDDSWVAFANNK + Deamidated (NQ) |
| 2523 |
576.2618 | 1150.5091 | 1150.5176 | -7.34 | 0 | 4 | 2 | 1Score > 20 indicates identity |
MTEGAGLAEEK + Oxidation (M) |
| 1427 |
495.2250 | 1482.6531 | 1482.6773 | -16.3 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
MSNGSAAVSPFNKR + 2 Deamidated (NQ); Oxidation (M) |
| 3103 |
630.2864 | 1887.8373 | 1887.8639 | -14.1 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
QFQEVEAVTFQYNQR + 2 Deamidated (NQ) |
| 774 |
441.2004 | 880.3863 | 880.3960 | -11.0 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
TGTMTQNK + Deamidated (NQ) |
| 1411 |
495.2250 | 1976.8708 | 1976.8707 | 0.067 | 1 | 4 | 1.7 | 1Score > 19 indicates identity |
AESGYTQEKMANVLGMSK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 7176 |
954.4337 | 3813.7058 | 3813.7739 | -17.9 | 1 | 4 | 1.6 | 1Score > 19 indicates identity |
MASFMGKCILACAVMFFGVLLGMQQANNGMIEMK + Oxidation (M) |
| 3276 |
643.7925 | 1285.5705 | 1285.5907 | -15.7 | 1 | 4 | 1.3 | 1Score > 18 indicates identity |
RLTGMFANGMR + Deamidated (NQ); 2 Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/