MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 7572)

Page: Previous 1 2 3 4 5 6 7 8 9 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
6138 873.3969 2617.1689 2617.1425 10.1 1 6 1.2 +1Score > 19 indicates identity DCGSDQFPDLSGRECYVGIDLSK
5611 832.8785 1663.7424 1663.7246 10.7 0 6 0.76 +1Score > 17 indicates identity MNDEEAQIIANNGVK + 3 Deamidated (NQ); Oxidation (M)
6319 886.9030 1771.7915 1771.8120 -11.6 1 6 0.8 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
1315 481.7188 961.4231 961.4352 -12.6 0 6 0.77 +1Score > 17 indicates identity LDQEQDSK
3166 630.2864 1258.5582 1258.5573 0.68 0 6 1.3 +1Score > 19 indicates identity IMDAAGYEVMK + 2 Oxidation (M)
641 427.6943 1706.7481 1706.7649 -9.84 0 6 0.57 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
5469 819.3723 2455.0951 2455.1391 -17.9 0 6 1.3 +1Score > 20 indicates identity FLYGTQGQGGEGQPQTQTALITR + 5 Deamidated (NQ)
5874 846.3846 1690.7546 1690.7686 -8.25 1 6 1.1 +1Score > 19 indicates identity QDVESYQKNEQPPK + 2 Deamidated (NQ)
1525 495.2250 1976.8708 1976.8633 3.80 0 6 1.2 +1Score > 19 indicates identity QMNGEDITQEEVEQAQK + Deamidated (NQ)
4849 765.3478 2293.0215 2293.0184 1.37 0 6 1.3 +1Score > 19 indicates identity SMMYEGLQHYFIVNFPQR + 2 Deamidated (NQ); 2 Oxidation (M)
1651 508.7311 2030.8955 2030.8626 16.2 0 6 0.63 +1Score > 16 indicates identity ASELETAFQTASSNANQMK + 4 Deamidated (NQ)
2594 589.7679 1177.5213 1177.5099 9.75 1 6 0.8 +1Score > 17 indicates identity GLADDDSDNKK + Deamidated (NQ)
2650 589.7679 2355.0427 2355.0835 -17.3 0 6 0.8 +1Score > 17 indicates identity AMDAEAGVMISASHNPVQDNGIK + Deamidated (NQ)
4756 765.3478 3057.3620 3057.3194 13.9 0 6 1.3 +1Score > 19 indicates identity MNTEQTIEVMNQNWTDIYYHLHMK + 3 Deamidated (NQ); Oxidation (M)
3131 630.2864 2517.1164 2517.1516 -14.0 1 6 1.3 +1Score > 19 indicates identity SGRQGDPGITQFYLSMEDELMK + Oxidation (M)
2606 589.7679 1177.5213 1177.5211 0.22 0 6 0.8 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
3078 630.2864 1258.5582 1258.5499 6.58 1 6 1.3 +1Score > 19 indicates identity HKDMNDLEEK + Deamidated (NQ)
5121 792.3600 1582.7055 1582.7045 0.64 1 6 0.83 +1Score > 20 indicates identity
Score > 17 indicates homology		 CQYETLVENNRR + 2 Deamidated (NQ)
5876 846.3846 1690.7546 1690.7686 -8.25 1 6 1.1 +1Score > 19 indicates identity QDVESYQKNEQPPK + 2 Deamidated (NQ)
6143 873.3969 2617.1689 2617.2193 -19.2 0 6 1.2 +1Score > 19 indicates identity LYEMFMGPLDASIAWSTTGLDGAR + Oxidation (M)
2291 562.7557 2246.9936 2247.0114 -7.91 1 6 0.89 +1Score > 18 indicates identity SKDEFGQLGTSFNEMADSLR + Oxidation (M)
6860 927.4214 1852.8283 1852.8512 -12.4 0 6 0.72 +1Score > 20 indicates identity
Score > 17 indicates homology		 TEMLTNNIANANTPGYK + 2 Deamidated (NQ)
2619 589.7679 1177.5213 1177.5099 9.74 1 6 0.82 +1Score > 17 indicates identity VDADSGEDDKK
6624 913.9153 1825.8160 1825.8516 -19.5 1 6 1.1 +1Score > 18 indicates identity MVDQYVRNLNSDLNK + 2 Deamidated (NQ); Oxidation (M)
2466 576.2618 1150.5091 1150.5255 -14.2 0 6 1.4 +1Score > 20 indicates identity FSQLNQNDGK + Deamidated (NQ)
476 414.1881 1239.5426 1239.5554 -10.3 1 6 1.3 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
1232 481.7188 961.4231 961.4352 -12.6 1 6 0.81 +1Score > 17 indicates identity DAGDQKAEK + Deamidated (NQ)
1921 535.7434 2138.9445 2138.9758 -14.6 0 6 0.76 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
1977 535.7434 2138.9445 2138.9711 -12.4 1 6 0.76 +1Score > 17 indicates identity AGINTVQELANKTEEDMMK + 2 Deamidated (NQ); Oxidation (M)
312 400.6820 799.3495 799.3646 -19.0 0 5 0.62 +1Score > 16 indicates identity MEHINR + Deamidated (NQ)
2419 576.2618 1725.7637 1725.7853 -12.5 1 5 1.4 +1Score > 20 indicates identity REQGHDIDAACGQLR + Deamidated (NQ)
96 387.1759 772.3372 772.3248 16.1 0 5 0.74 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
509 414.1881 1239.5426 1239.5628 -16.3 0 5 1.3 +1Score > 19 indicates identity IGQMLMPDFR + Deamidated (NQ); 2 Oxidation (M)
1386 495.2250 988.4354 988.4219 13.7 0 5 1.2 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
1137 468.2127 1868.8217 1868.8437 -11.7 1 5 1.2 +1Score > 19 indicates identity MIQKMAEYQSYTGFR + Deamidated (NQ); Oxidation (M)
150 387.1759 1158.5058 1158.4975 7.15 0 5 0.75 +1Score > 17 indicates identity EHLQTCNEK + Deamidated (NQ)
3107 630.2864 1258.5582 1258.5798 -17.2 0 5 1.4 +1Score > 19 indicates identity MVHMIDVNER + Oxidation (M)
3375 643.7925 1285.5705 1285.5907 -15.7 1 5 0.92 +1Score > 18 indicates identity RLTGMFANGMR + Deamidated (NQ); 2 Oxidation (M)
4899 765.3478 2293.0215 2293.0507 -12.7 0 5 1.4 +1Score > 19 indicates identity MYHLYTHNDLDGVGCGILAK + Deamidated (NQ); Oxidation (M)
6623 913.9153 3651.6320 3651.6991 -18.4 1 5 1.1 +1Score > 18 indicates identity EFDIITTGDYQLILEDDQELYAYLRNGADEK + 2 Deamidated (NQ)
1648 508.7311 1015.4477 1015.4323 15.2 1 5 0.69 +1Score > 16 indicates identity MMKMMAGGK + 2 Oxidation (M)
1316 481.7188 961.4231 961.4101 13.6 0 5 0.85 +1Score > 17 indicates identity NGATNVNNR + 3 Deamidated (NQ)
6515 900.4092 1798.8038 1798.8264 -12.5 1 5 1.2 +1Score > 19 indicates identity SGMSPCSGVIVGMKETK + 2 Oxidation (M)
320 400.6820 799.3495 799.3422 9.09 0 5 0.65 +1Score > 16 indicates identity FTMEEK + Oxidation (M)
1494 495.2250 1482.6531 1482.6409 8.25 0 5 1.3 +1Score > 19 indicates identity NDNHSPAPQMINK + 2 Deamidated (NQ); Oxidation (M)
1404 495.2250 988.4354 988.4219 13.7 0 5 1.3 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
2825 603.2741 1204.5337 1204.5394 -4.75 0 5 1.3 +1Score > 19 indicates identity MSGAETIHNTK + Deamidated (NQ); Oxidation (M)
5170 792.3600 3165.4111 3165.3704 12.8 1 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 WNGLADLKLMNMMGYDAMTFGNHEFDK + Deamidated (NQ); Oxidation (M)
2433 576.2618 1150.5091 1150.5295 -17.7 0 5 1.5 +1Score > 20 indicates identity LGYFHEEEK
5823 846.3846 3381.5092 3381.4581 15.1 0 5 1.2 +1Score > 19 indicates identity SLLDDGSFEEFNQDMMSENPLEFPGYLEK + Deamidated (NQ)
2414 576.2618 2301.0183 2301.0252 -3.03 1 5 1.5 +1Score > 20 indicates identity NAKTQSLACVASYEAMANNEK + 2 Deamidated (NQ)
4131 711.3232 1420.6319 1420.6218 7.10 1 5 1.4 +1Score > 19 indicates identity EPENQQAFRGSR + 3 Deamidated (NQ)
963 454.7066 907.3986 907.3957 3.22 0 5 1.2 +1Score > 19 indicates identity MDQQQLK + 2 Deamidated (NQ); Oxidation (M)
1902 535.7434 1069.4723 1069.4750 -2.55 1 5 0.81 +1Score > 17 indicates identity MDQFKQEK + Deamidated (NQ); Oxidation (M)
2510 576.2618 1725.7637 1725.7662 -1.43 1 5 1.5 +1Score > 20 indicates identity SDNLKSQMQDIMSGR + Deamidated (NQ); Oxidation (M)
4125 711.3232 2130.9479 2130.9384 4.47 1 5 1.4 +1Score > 19 indicates identity QDMACLIREYQEVMNSK + Deamidated (NQ); Oxidation (M)
4144 711.3232 1420.6319 1420.6504 -13.0 0 5 1.4 +1Score > 19 indicates identity DAMDGLSLANQLR + 2 Deamidated (NQ); Oxidation (M)
1275 481.7188 961.4231 961.4352 -12.6 1 5 0.87 +1Score > 17 indicates identity QEKQADDK + Deamidated (NQ)
551 427.6943 1706.7481 1706.7649 -9.84 0 5 0.65 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
128 387.1759 1544.6744 1544.7028 -18.4 0 5 0.79 +1Score > 17 indicates identity TQEMLEHELEASK + Deamidated (NQ)
2542 576.2618 1150.5091 1150.5077 1.26 1 5 1.5 +1Score > 20 indicates identity WKNMTADER + Deamidated (NQ)
775 441.2004 1320.5795 1320.6044 -18.9 1 5 1.5 +1Score > 19 indicates identity LSTKNQENEEK + 2 Deamidated (NQ)
5114 792.3600 1582.7055 1582.7045 0.64 1 5 0.47 +1Score > 20 indicates identity
Score > 14 indicates homology		 CQYETLVENNRR + 2 Deamidated (NQ)
4026 697.8171 1393.6196 1393.6184 0.89 0 5 0.97 +1Score > 17 indicates identity MNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
1851 522.2372 2084.9199 2084.9361 -7.77 0 5 1.4 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2120 549.2496 1096.4846 1096.4754 8.42 1 5 0.99 +1Score > 20 indicates identity
Score > 18 indicates homology		 CMRSLDGSR + Oxidation (M)
2155 549.2496 2192.9692 2192.9644 2.18 0 5 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 TTQANEIMINSETFDHADR + Deamidated (NQ)
5467 819.3723 3273.4602 3273.5163 -17.1 1 5 1.6 +1Score > 20 indicates identity MTTISNAMSRQVATISSNQTVQEAAELMSR + 3 Deamidated (NQ); Oxidation (M)
1515 495.2250 1976.8708 1976.8633 3.80 0 5 1.4 +1Score > 19 indicates identity QMNGEDITQEEVEQAQK + Deamidated (NQ)
2432 576.2618 1725.7637 1725.7781 -8.34 0 5 1.6 +1Score > 20 indicates identity VHSECLTGDVFGSYR
1387 495.2250 988.4354 988.4219 13.7 0 5 1.4 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
1592 508.7311 2030.8955 2030.8626 16.2 1 5 0.74 +1Score > 16 indicates identity NDTKMTYEELEEQLNR + 3 Deamidated (NQ); Oxidation (M)
2776 603.2741 1806.8005 1806.7838 9.24 1 5 1.4 +1Score > 19 indicates identity AMGMVEMKQGEGTYVK + Deamidated (NQ); 3 Oxidation (M)
2884 603.2741 1204.5337 1204.5571 -19.5 0 5 1.4 +1Score > 19 indicates identity STAEAENVDIR + Deamidated (NQ)
163 387.1759 772.3372 772.3248 16.1 0 5 0.82 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
6616 913.9153 3651.6320 3651.6991 -18.4 1 5 1.2 +1Score > 18 indicates identity EFDIITTGDYQLILEDDQELYAYLRNGADEK + 2 Deamidated (NQ)
796 441.2004 1320.5795 1320.6020 -17.0 0 5 1.5 +1Score > 19 indicates identity GQILFMEDDPR + Deamidated (NQ)
3701 670.8048 1339.5951 1339.6190 -17.9 1 5 1.2 +1Score > 18 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
2348 562.7557 1123.4968 1123.5002 -3.00 0 5 1 +1Score > 18 indicates identity GMGIIGMEER + 2 Oxidation (M)
2702 589.7679 1177.5213 1177.5211 0.22 0 5 0.94 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
2527 576.2618 1150.5091 1150.5063 2.45 0 5 1.6 +1Score > 20 indicates identity MNQIQLEEK + 3 Deamidated (NQ); Oxidation (M)
4448 738.3355 2211.9847 2212.0028 -8.16 1 5 0.58 +1Score > 20 indicates identity
Score > 15 indicates homology		 MDNQELTMPTKYDPSAVEK + Oxidation (M)
6159 873.3969 1744.7793 1744.7726 3.80 0 5 1.5 +1Score > 19 indicates identity EDGENHWMVEGLVSK + Oxidation (M)
6991 940.9276 3759.6811 3759.7174 -9.64 1 5 0.9 +1Score > 17 indicates identity KELIEEMGDVMGNLIMLAGIYGVSLEDMMDAHR + 5 Oxidation (M)
3212 630.2864 1258.5582 1258.5798 -17.2 0 5 1.6 +1Score > 19 indicates identity MVHMIDVNER + Oxidation (M)
5271 805.8662 3219.4357 3219.3819 16.7 1 5 1.3 +1Score > 19 indicates identity AGNSAMANNQFTIGKNLNTVESDISSMNNR + 6 Deamidated (NQ); Oxidation (M)
3920 697.8171 1393.6196 1393.6473 -19.9 0 5 1 +1Score > 17 indicates identity QSTQEELANAFR + Deamidated (NQ)
748 441.2004 1320.5795 1320.6058 -19.9 1 5 1.6 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
5698 832.8785 1663.7424 1663.7624 -12.0 1 5 0.93 +1Score > 17 indicates identity NRMNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
315 400.6820 1598.6989 1598.7286 -18.6 0 5 0.73 +1Score > 16 indicates identity DMFNLQANAFDIAK + 2 Deamidated (NQ)
5759 832.8785 1663.7424 1663.7480 -3.34 1 5 0.94 +1Score > 17 indicates identity TARNMNPLMAMAADR + 2 Deamidated (NQ)
1172 468.2127 1868.8217 1868.8462 -13.1 0 5 1.4 +1Score > 19 indicates identity TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M)
4361 724.8293 1447.6441 1447.6215 15.6 0 5 0.99 +1Score > 17 indicates identity QWSAEDEEAVQR + Deamidated (NQ)
5152 792.3600 3165.4111 3165.3704 12.8 1 5 1 +1Score > 20 indicates identity
Score > 17 indicates homology		 WNGLADLKLMNMMGYDAMTFGNHEFDK + Deamidated (NQ); Oxidation (M)
6190 873.3969 1744.7793 1744.7865 -4.17 0 5 1.5 +1Score > 19 indicates identity EFSDEMNVFLQQLK + 2 Deamidated (NQ); Oxidation (M)
4094 711.3232 2130.9479 2130.9635 -7.33 1 5 1.6 +1Score > 19 indicates identity MDNQVLQAIYEMQKEMK + Deamidated (NQ); 2 Oxidation (M)
47 387.1759 1544.6744 1544.6673 4.60 0 5 0.87 +1Score > 17 indicates identity EQMMYDMEALLR + Oxidation (M)
434 414.1881 1239.5426 1239.5554 -10.3 1 5 1.5 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
1777 522.2372 1042.4599 1042.4753 -14.8 0 5 1.6 +1Score > 19 indicates identity MTDASLSFR + Oxidation (M)
571 427.6943 853.3741 853.3786 -5.31 1 5 0.72 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/