MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 201–300 (out of 7572)

Page: Previous 1 2 3 4 5 6 7 8 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
838 441.2004 1320.5795 1320.6058 -19.9 1 7 0.93 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
168 387.1759 1544.6744 1544.6995 -16.2 0 7 0.51 +1Score > 17 indicates identity DYTLSDNGSGFEIK
978 454.7066 907.3986 907.4069 -9.18 0 7 0.78 +1Score > 19 indicates identity MESGETVR
413 414.1881 826.3617 826.3643 -3.15 0 7 0.9 +1Score > 19 indicates identity MTAGFQR + Deamidated (NQ); Oxidation (M)
480 414.1881 1652.7235 1652.7318 -5.03 0 7 0.91 +1Score > 19 indicates identity DWAEALEAYAQTER + Deamidated (NQ)
149 387.1759 1544.6744 1544.7028 -18.4 0 7 0.52 +1Score > 17 indicates identity TQEMLEHELEASK + Deamidated (NQ)
1250 481.7188 961.4231 961.4352 -12.6 1 7 0.59 +1Score > 17 indicates identity DAGDQKAEK + Deamidated (NQ)
975 454.7066 1814.7972 1814.8033 -3.34 0 7 0.83 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
3178 630.2864 2517.1164 2517.1594 -17.1 1 7 0.99 +1Score > 19 indicates identity ANGLSGAMFWDFSGDSNRTLLNK + Deamidated (NQ); Oxidation (M)
40 387.1759 1544.6744 1544.6994 -16.2 0 7 0.54 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
1474 495.2250 1482.6531 1482.6548 -1.13 0 7 0.9 +1Score > 19 indicates identity MNNIFLDNLQNK + 4 Deamidated (NQ); Oxidation (M)
3149 630.2864 1258.5582 1258.5466 9.24 0 7 1 +1Score > 19 indicates identity ENGGEAVYYTR + Deamidated (NQ)
6633 913.9153 1825.8160 1825.8048 6.12 0 7 0.8 +1Score > 18 indicates identity AVLNFMAMMENAVHAK + 2 Deamidated (NQ); 3 Oxidation (M)
2248 562.7557 2246.9936 2247.0331 -17.6 1 7 0.68 +1Score > 18 indicates identity QLDSFVDNVNQYKQYQEK + 2 Deamidated (NQ)
5486 819.3723 1636.7301 1636.7324 -1.40 0 7 1.1 +1Score > 20 indicates identity SQLMQCAQLINQAK + 5 Deamidated (NQ)
642 427.6943 853.3741 853.3786 -5.31 1 7 0.46 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
5636 832.8785 1663.7424 1663.7698 -16.4 0 7 0.61 +1Score > 17 indicates identity LLNFMSEHMTANEK
2760 603.2741 2409.0673 2409.0688 -0.62 0 7 0.96 +1Score > 19 indicates identity NYIFSYINEHPEQFYSDLK + 3 Deamidated (NQ)
3179 630.2864 1258.5582 1258.5717 -10.7 0 7 1 +1Score > 19 indicates identity ENQWVDEPIK + 2 Deamidated (NQ)
848 441.2004 880.3863 880.3960 -11.0 0 7 1 +1Score > 19 indicates identity MTETQQK + Oxidation (M)
1548 508.7311 2030.8955 2030.8891 3.12 0 7 0.5 +1Score > 16 indicates identity DEFGQLGTSFNEMAESLR + Deamidated (NQ)
489 414.1881 826.3617 826.3643 -3.15 0 7 0.98 +1Score > 19 indicates identity GGQMQYK + Oxidation (M)
3208 630.2864 1258.5582 1258.5578 0.32 0 7 1 +1Score > 19 indicates identity AEAVNDQFHAR + 2 Deamidated (NQ)
3125 630.2864 1887.8373 1887.8315 3.08 0 7 1 +1Score > 19 indicates identity YEQDPYHYINQFIR + 3 Deamidated (NQ)
311 400.6820 1598.6989 1598.7286 -18.6 0 7 0.48 +1Score > 16 indicates identity DMFNLQANAFDIAK + 2 Deamidated (NQ)
664 427.6943 853.3741 853.3817 -9.01 0 7 0.47 +1Score > 16 indicates identity ANVGDSYK + Deamidated (NQ)
127 387.1759 1544.6744 1544.6994 -16.2 0 7 0.57 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
3664 670.8048 1339.5951 1339.5826 9.28 0 7 0.83 +1Score > 18 indicates identity QAFESAAAEMGGR + Oxidation (M)
1520 495.2250 1976.8708 1976.8898 -9.61 0 6 0.97 +1Score > 19 indicates identity QGSSEMVAQHLVDAGFER + Deamidated (NQ); Oxidation (M)
2191 549.2496 1096.4846 1096.4785 5.56 0 6 1 +1Score > 20 indicates identity
Score > 19 indicates homology		 YTNATDADAR
124 387.1759 1158.5058 1158.5049 0.74 0 6 0.59 +1Score > 17 indicates identity SVMFGAMAEGK + 2 Oxidation (M)
152 387.1759 1158.5058 1158.5265 -17.9 0 6 0.59 +1Score > 17 indicates identity QQLDAANQNR + 2 Deamidated (NQ)
719 441.2004 880.3863 880.3857 0.77 0 6 1.1 +1Score > 19 indicates identity MMMIDPK + Oxidation (M)
3130 630.2864 1258.5582 1258.5798 -17.2 0 6 1.1 +1Score > 19 indicates identity MVHMIDVNER + Oxidation (M)
391 414.1881 1239.5426 1239.5475 -3.94 0 6 1 +1Score > 19 indicates identity MNQLMNSEIK + Deamidated (NQ); 2 Oxidation (M)
2363 562.7557 1123.4968 1123.5145 -15.8 1 6 0.74 +1Score > 18 indicates identity RYEEVDGQK + Deamidated (NQ)
132 387.1759 1544.6744 1544.6995 -16.2 0 6 0.6 +1Score > 17 indicates identity DYTLSDNGSGFEIK
1127 468.2127 934.4109 934.4290 -19.4 1 6 1 +1Score > 19 indicates identity AEGSERMR
407 414.1881 826.3617 826.3643 -3.15 0 6 1 +1Score > 19 indicates identity MYVDGAR + Oxidation (M)
740 441.2004 1320.5795 1320.5979 -14.0 0 6 1.1 +1Score > 19 indicates identity TTPMANASNIER + Deamidated (NQ); Oxidation (M)
111 387.1759 1158.5058 1158.5193 -11.6 0 6 0.6 +1Score > 17 indicates identity NGADYYTNIK + Deamidated (NQ)
229 400.6820 799.3495 799.3422 9.09 0 6 0.51 +1Score > 16 indicates identity FTMEEK + Oxidation (M)
365 414.1881 826.3617 826.3683 -7.99 0 6 1 +1Score > 19 indicates identity AYWQMK + Deamidated (NQ)
1259 481.7188 1922.8463 1922.8779 -16.4 1 6 0.68 +1Score > 17 indicates identity SDNIGEEIMGKQADSIAK + 2 Deamidated (NQ); Oxidation (M)
6816 927.4214 1852.8283 1852.8625 -18.4 1 6 0.27 +1Score > 20 indicates identity
Score > 13 indicates homology		 MQQQQFDQLTTAEKR + 2 Deamidated (NQ)
994 454.7066 907.3986 907.4069 -9.18 0 6 0.93 +1Score > 19 indicates identity MESGETVR
889 454.7066 907.3986 907.3883 11.3 0 6 0.94 +1Score > 19 indicates identity TGTTDDNGK
1492 495.2250 988.4354 988.4219 13.7 0 6 1 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
2545 576.2618 1150.5091 1150.5255 -14.2 0 6 1.2 +1Score > 20 indicates identity FSQLNQNDGK + Deamidated (NQ)
281 400.6820 1598.6989 1598.6956 2.06 0 6 0.52 +1Score > 16 indicates identity MNTVVTNMAGNVWK + 3 Deamidated (NQ); 2 Oxidation (M)
1267 481.7188 961.4231 961.4352 -12.6 0 6 0.68 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
3692 670.8048 1339.5951 1339.6190 -17.9 1 6 0.88 +1Score > 18 indicates identity KDSGFQMNQLR + Deamidated (NQ); Oxidation (M)
75 387.1759 1544.6744 1544.6995 -16.2 0 6 0.61 +1Score > 17 indicates identity DYTLSDNGSGFEIK
1704 522.2372 2084.9199 2084.9110 4.28 0 6 1.1 +1Score > 19 indicates identity IPSGGFYSMTTNGDGSVNHK + Deamidated (NQ); Oxidation (M)
563 427.6943 1706.7481 1706.7801 -18.7 0 6 0.51 +1Score > 16 indicates identity FHNDPDHEWILER
1241 481.7188 961.4231 961.4352 -12.6 0 6 0.68 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
299 400.6820 1598.6989 1598.6812 11.1 0 6 0.52 +1Score > 16 indicates identity MLMQVMQDPEMAK + 3 Oxidation (M)
2497 576.2618 1725.7637 1725.7958 -18.6 0 6 1.2 +1Score > 20 indicates identity TAADAPDHEAVVYPDR
6482 900.4092 3597.6076 3597.6578 -13.9 1 6 0.99 +1Score > 19 indicates identity TAKAIEQADQSAMEQEAMCFWIFHVIQQIR + 3 Deamidated (NQ); Oxidation (M)
806 441.2004 880.3863 880.3848 1.77 0 6 1.1 +1Score > 19 indicates identity NEMIQTK + 2 Deamidated (NQ); Oxidation (M)
1345 481.7188 961.4231 961.4352 -12.6 0 6 0.69 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
1079 468.2127 1401.6163 1401.6160 0.18 0 6 1 +1Score > 19 indicates identity YPHELSGGQQQR + 3 Deamidated (NQ)
66 387.1759 772.3372 772.3248 16.1 0 6 0.63 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1477 495.2250 1976.8708 1976.8608 5.07 1 6 1.1 +1Score > 19 indicates identity MTQDEFYMKEAVNEAR + Oxidation (M)
2546 576.2618 1150.5091 1150.5189 -8.50 1 6 1.2 +1Score > 20 indicates identity MNNRNNPFK + Deamidated (NQ); Oxidation (M)
1577 508.7311 2030.8955 2030.9003 -2.40 1 6 0.57 +1Score > 16 indicates identity YEKMLNTYSHQEETSR + Oxidation (M)
974 454.7066 1814.7972 1814.7788 10.1 0 6 0.98 +1Score > 19 indicates identity DFPAVPYSGWDFNDGK + Deamidated (NQ)
7350 967.9399 3867.7304 3867.7446 -3.67 0 6 0.65 +1Score > 17 indicates identity SALGSGAGNTGDFLIVNNGINATNYIDPDVSDQNVVGNA + 5 Deamidated (NQ)
1917 535.7434 2138.9445 2138.9758 -14.6 0 6 0.66 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
926 454.7066 907.3986 907.4035 -5.44 0 6 0.99 +1Score > 19 indicates identity EEAADAFR
2113 549.2496 2192.9692 2192.9653 1.79 1 6 0.44 +1Score > 20 indicates identity
Score > 15 indicates homology		 QESGSMVAFHACPNCKIEK + Deamidated (NQ)
2649 589.7679 1177.5213 1177.5211 0.22 0 6 0.73 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
507 414.1881 1239.5426 1239.5666 -19.4 1 6 1.1 +1Score > 19 indicates identity YMDEIGRNAR + Oxidation (M)
1775 522.2372 1563.6899 1563.7086 -12.0 1 6 1.2 +1Score > 19 indicates identity GAELEQKSQDMEAK + Deamidated (NQ)
790 441.2004 880.3863 880.4034 -19.4 0 6 1.2 +1Score > 19 indicates identity EMTEIMK
3661 670.8048 1339.5951 1339.5826 9.28 0 6 0.94 +1Score > 18 indicates identity QAFESAAAEMGGR + Oxidation (M)
4257 724.8293 2895.2883 2895.2756 4.37 1 6 0.75 +1Score > 17 indicates identity LQTDSSYQGLADDMSAFQSKGFQPEK + 2 Deamidated (NQ); Oxidation (M)
5531 819.3723 1636.7301 1636.7501 -12.3 1 6 1.2 +1Score > 20 indicates identity KSMGDQLNQLIDQK + 4 Deamidated (NQ); Oxidation (M)
6706 913.9153 3651.6320 3651.6991 -18.4 1 6 0.96 +1Score > 18 indicates identity EFDIITTGDYQLILEDDQELYAYLRNGADEK + 2 Deamidated (NQ)
5720 832.8785 1663.7424 1663.7698 -16.4 0 6 0.72 +1Score > 17 indicates identity LLNFMSEHMTANEK
553 427.6943 853.3741 853.3673 7.87 1 6 0.54 +1Score > 16 indicates identity MEMNKGK + Deamidated (NQ); Oxidation (M)
2162 549.2496 1644.7269 1644.7413 -8.79 1 6 0.58 +1Score > 20 indicates identity
Score > 16 indicates homology		 DMKQTSSHPSPDSTK
443 414.1881 1652.7235 1652.7529 -17.8 0 6 1.1 +1Score > 19 indicates identity EGFNSLSQSEQQVAK + 2 Deamidated (NQ)
5512 819.3723 2455.0951 2455.0971 -0.81 0 6 1.3 +1Score > 20 indicates identity QVVAVCGDGGFSMSMHDFPTAVK + Oxidation (M)
2755 603.2741 1806.8005 1806.7838 9.24 1 6 1.1 +1Score > 19 indicates identity AMGMVEMKQGEGTYVK + Deamidated (NQ); 3 Oxidation (M)
4269 724.8293 2895.2883 2895.3241 -12.4 0 6 0.77 +1Score > 17 indicates identity MIQVALANMYTELSNVMEQHGFDPR + 2 Deamidated (NQ)
1359 481.7188 961.4231 961.4101 13.6 1 6 0.75 +1Score > 17 indicates identity ERDEEER
2813 603.2741 2409.0673 2409.0828 -6.41 0 6 1.2 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
2148 549.2496 1096.4846 1096.5045 -18.2 0 6 1 +1Score > 20 indicates identity
Score > 18 indicates homology		 AFVVMMDPR + 2 Oxidation (M)
1466 495.2250 1482.6531 1482.6548 -1.13 0 6 1.1 +1Score > 19 indicates identity MNNIFLDNLQNK + 4 Deamidated (NQ); Oxidation (M)
385 414.1881 1239.5426 1239.5587 -13.0 1 6 1.2 +1Score > 19 indicates identity MMTAKNLQDR + Deamidated (NQ); 2 Oxidation (M)
2460 576.2618 2301.0183 2301.0623 -19.1 0 6 1.3 +1Score > 20 indicates identity SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ)
3038 616.7802 2463.0917 2463.1144 -9.21 0 6 0.79 +1Score > 17 indicates identity MANQNSSNQLLVPGAAQAIEQMK + 5 Deamidated (NQ); Oxidation (M)
2098 549.2496 1096.4846 1096.4754 8.42 1 6 0.29 +1Score > 20 indicates identity
Score > 13 indicates homology		 CMRSLDGSR + Oxidation (M)
3956 697.8171 1393.6196 1393.6085 7.99 0 6 0.82 +1Score > 17 indicates identity MNDNSAPFHFSK
1075 468.2127 1401.6163 1401.6160 0.18 0 6 1.1 +1Score > 19 indicates identity YPHELSGGQQQR + 3 Deamidated (NQ)
7464 980.1954 3916.7526 3916.7754 -5.81 1 6 0.59 +1Score > 16 indicates identity GLQMLCQLDHRGGQGSDPHTGDGAGIMMQIPDAFFK + 2 Oxidation (M)
397 414.1881 826.3617 826.3643 -3.15 0 6 1.2 +1Score > 19 indicates identity GGQMQYK + Oxidation (M)
2003 535.7434 2138.9445 2138.9758 -14.6 0 6 0.72 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
3427 657.2986 2625.1655 2625.1408 9.40 0 6 1.3 +1Score > 19 indicates identity DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/