MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 101–200 (out of 7572)

Page: Previous 1 2 3 4 5 6 7 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
65 387.1759 1544.6744 1544.6994 -16.2 0 9 0.3 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
2456 576.2618 1150.5091 1150.5077 1.25 0 9 0.57 +1Score > 20 indicates identity NMGDPLFANR + Deamidated (NQ); Oxidation (M)
2303 562.7557 2246.9936 2247.0260 -14.4 1 9 0.37 +1Score > 18 indicates identity EVQDMITKNASHGMVGDLNR + Deamidated (NQ); 2 Oxidation (M)
1788 522.2372 1563.6899 1563.7165 -17.0 1 9 0.55 +1Score > 19 indicates identity DNNNFDKLVDENK
2468 576.2618 1725.7637 1725.7590 2.75 0 9 0.6 +1Score > 20 indicates identity MSFDPNNVLMQDAVK + 2 Deamidated (NQ); Oxidation (M)
19 387.1759 772.3372 772.3248 16.1 0 9 0.31 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
2453 576.2618 1150.5091 1150.5189 -8.50 1 9 0.6 +1Score > 20 indicates identity MNNRNNPFK + Deamidated (NQ); Oxidation (M)
2876 603.2741 2409.0673 2409.0298 15.6 0 9 0.55 +1Score > 19 indicates identity NDPDVWHDGYGPAVATDFYNR + Deamidated (NQ)
7186 954.4337 1906.8529 1906.8156 19.6 0 9 0.5 +1Score > 19 indicates identity QDDWLFVQMGHNDASK + Deamidated (NQ); Oxidation (M)
1401 495.2250 988.4354 988.4219 13.7 0 9 0.53 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
2001 535.7434 1069.4723 1069.4750 -2.54 1 9 0.33 +1Score > 17 indicates identity YNLAKDSMQ + Deamidated (NQ)
1385 495.2250 988.4354 988.4219 13.7 0 9 0.54 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
308 400.6820 1598.6989 1598.6956 2.06 0 9 0.27 +1Score > 16 indicates identity MNTVVTNMAGNVWK + 3 Deamidated (NQ); 2 Oxidation (M)
555 427.6943 853.3741 853.3673 7.87 1 9 0.27 +1Score > 16 indicates identity MEMNKGK + Deamidated (NQ); Oxidation (M)
36 387.1759 772.3372 772.3248 16.1 0 9 0.32 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1018 454.7066 907.3986 907.3957 3.23 0 9 0.51 +1Score > 19 indicates identity MNISDEAK + Deamidated (NQ)
25 387.1759 772.3372 772.3248 16.1 0 9 0.34 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
3917 697.8171 1393.6196 1393.6222 -1.85 1 9 0.41 +1Score > 17 indicates identity ESAEEFRNQGAR + Deamidated (NQ)
800 441.2004 1320.5795 1320.6045 -18.9 0 9 0.63 +1Score > 19 indicates identity DGTINTESIDEK
395 414.1881 826.3617 826.3643 -3.15 0 9 0.6 +1Score > 19 indicates identity MYVDGAR + Oxidation (M)
966 454.7066 907.3986 907.3957 3.23 0 9 0.52 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
5907 846.3846 2536.1319 2536.1315 0.17 1 9 0.54 +1Score > 19 indicates identity EQSEEFYQFLQSDQAVKAMEK + 2 Deamidated (NQ)
5297 805.8662 1609.7179 1609.7328 -9.26 0 9 0.54 +1Score > 19 indicates identity MSQIEGMDVGDVLGK + 2 Oxidation (M)
5748 832.8785 1663.7424 1663.7723 -18.0 0 9 0.38 +1Score > 17 indicates identity TADGQVVTAEQMLER + Deamidated (NQ); Oxidation (M)
58 387.1759 772.3372 772.3248 16.1 0 9 0.35 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
925 454.7066 1814.7972 1814.8179 -11.4 1 9 0.54 +1Score > 19 indicates identity FGMDDSTPIQSKMVSR + Deamidated (NQ); Oxidation (M)
1650 508.7311 2030.8955 2030.8851 5.12 1 9 0.32 +1Score > 16 indicates identity MGNEDNQKQPEELEQNK + Deamidated (NQ)
73 387.1759 1544.6744 1544.6824 -5.17 1 9 0.35 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
5357 805.8662 1609.7179 1609.7431 -15.7 0 9 0.55 +1Score > 19 indicates identity NIQASAQSTGSTTVSR + 3 Deamidated (NQ)
791 441.2004 880.3863 880.4034 -19.4 0 9 0.66 +1Score > 19 indicates identity EVLDMMK + Oxidation (M)
827 441.2004 1760.7727 1760.8006 -15.9 0 9 0.66 +1Score > 19 indicates identity SVNPPDDSWVAFANNK + Deamidated (NQ)
1451 495.2250 1976.8708 1976.8997 -14.6 0 9 0.61 +1Score > 19 indicates identity DDAVMVGDNLNTDILGASR + 2 Deamidated (NQ)
376 414.1881 1239.5426 1239.5554 -10.3 1 9 0.64 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
1146 468.2127 1868.8217 1868.8462 -13.1 0 8 0.62 +1Score > 19 indicates identity TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M)
2480 576.2618 1725.7637 1725.7590 2.75 0 8 0.72 +1Score > 20 indicates identity MSFDPNNVLMQDAVK + 2 Deamidated (NQ); Oxidation (M)
165 387.1759 1158.5058 1158.5193 -11.7 0 8 0.38 +1Score > 17 indicates identity GELPEGWDQK + Deamidated (NQ)
5489 819.3723 1636.7301 1636.7555 -15.6 0 8 0.72 +1Score > 20 indicates identity GASYFDSALSFGMIR + Oxidation (M)
1282 481.7188 961.4231 961.4352 -12.6 1 8 0.42 +1Score > 17 indicates identity QEKQADDK + Deamidated (NQ)
232 400.6820 1598.6989 1598.7246 -16.1 1 8 0.32 +1Score > 16 indicates identity REDMLQLFSDSDK + Oxidation (M)
5710 832.8785 1663.7424 1663.7723 -18.0 0 8 0.42 +1Score > 17 indicates identity TADGQVVTAEQMLER + Deamidated (NQ); Oxidation (M)
474 414.1881 1652.7235 1652.7166 4.18 0 8 0.68 +1Score > 19 indicates identity EGSTQLNAFEEVGDR + 2 Deamidated (NQ)
162 387.1759 772.3372 772.3351 2.65 0 8 0.39 +1Score > 17 indicates identity DGTHSEK
2985 616.7802 2463.0917 2463.1336 -17.0 1 8 0.46 +1Score > 17 indicates identity TTQANEIMINSETFDHADRLR + 2 Deamidated (NQ)
967 454.7066 907.3986 907.3957 3.23 0 8 0.61 +1Score > 19 indicates identity MNISDEAK + Deamidated (NQ)
231 400.6820 799.3495 799.3646 -19.0 0 8 0.34 +1Score > 16 indicates identity MEHINR + Deamidated (NQ)
721 441.2004 1760.7727 1760.7451 15.7 0 8 0.73 +1Score > 19 indicates identity EGEFEQNETFLAAMK + 2 Deamidated (NQ); Oxidation (M)
266 400.6820 1598.6989 1598.7246 -16.1 1 8 0.34 +1Score > 16 indicates identity AENTEKMVDQYVR + Deamidated (NQ); Oxidation (M)
485 414.1881 1652.7235 1652.7529 -17.8 0 8 0.7 +1Score > 19 indicates identity QDGSENQVSFSNVLK + 2 Deamidated (NQ)
4932 778.8539 1555.6932 1555.7114 -11.7 1 8 0.57 +1Score > 18 indicates identity HSGENQEEQRLVK + 3 Deamidated (NQ)
6497 900.4092 1798.8038 1798.8230 -10.6 1 8 0.65 +1Score > 19 indicates identity QFLSQCELDMRDIK + Deamidated (NQ); Oxidation (M)
2115 549.2496 1096.4846 1096.4785 5.56 0 8 0.21 +1Score > 20 indicates identity
Score > 14 indicates homology		 YTNATDADAR
3726 670.8048 1339.5951 1339.5892 4.41 0 8 0.59 +1Score > 18 indicates identity DESELVESYNR
1996 535.7434 2138.9445 2138.9758 -14.6 0 8 0.43 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
2243 562.7557 2246.9936 2247.0291 -15.8 1 8 0.52 +1Score > 18 indicates identity SIERNEWEDNTPETEGLTK
296 400.6820 799.3495 799.3646 -19.0 0 8 0.35 +1Score > 16 indicates identity MEHINR + Deamidated (NQ)
1266 481.7188 961.4231 961.4352 -12.6 0 8 0.47 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
1495 495.2250 1482.6531 1482.6409 8.25 0 8 0.71 +1Score > 19 indicates identity NDNHSPAPQMINK + 2 Deamidated (NQ); Oxidation (M)
2495 576.2618 2301.0183 2301.0623 -19.1 0 8 0.82 +1Score > 20 indicates identity SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ)
3263 643.7925 1285.5705 1285.5615 7.02 0 8 0.52 +1Score > 18 indicates identity YDDYWDGKPK
23 387.1759 1158.5058 1158.4975 7.15 0 8 0.43 +1Score > 17 indicates identity EHLQTCNEK + Deamidated (NQ)
290 400.6820 1598.6989 1598.7181 -12.0 1 8 0.36 +1Score > 16 indicates identity MKQAFESAAAEMGGR + Oxidation (M)
556 427.6943 853.3741 853.3786 -5.31 1 8 0.35 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
5471 819.3723 2455.0951 2455.1069 -4.80 0 8 0.82 +1Score > 20 indicates identity SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M)
24 387.1759 1158.5058 1158.4975 7.15 0 8 0.43 +1Score > 17 indicates identity EHLQTCNEK + Deamidated (NQ)
3439 657.2986 1312.5827 1312.5574 19.3 0 8 0.82 +1Score > 19 indicates identity MQTGMSVQEMR + Oxidation (M)
499 414.1881 1652.7235 1652.7220 0.91 0 8 0.77 +1Score > 19 indicates identity DDTWVFTWQGNER
1642 508.7311 2030.8955 2030.9215 -12.8 1 8 0.4 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
1097 468.2127 934.4109 934.4032 8.19 0 8 0.74 +1Score > 19 indicates identity ETEGGEWK
3121 630.2864 1258.5582 1258.5573 0.68 0 8 0.82 +1Score > 19 indicates identity MMNISDFQIK + Deamidated (NQ); 2 Oxidation (M)
333 400.6820 1598.6989 1598.6738 15.7 0 8 0.38 +1Score > 16 indicates identity TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M)
462 414.1881 826.3617 826.3643 -3.15 0 8 0.78 +1Score > 19 indicates identity MYVDGAR + Oxidation (M)
3080 630.2864 1887.8373 1887.8639 -14.1 0 8 0.83 +1Score > 19 indicates identity QFQEVEAVTFQYNQR + 2 Deamidated (NQ)
5120 792.3600 3165.4111 3165.4708 -18.9 1 8 0.38 +1Score > 20 indicates identity
Score > 16 indicates homology		 IEQMKAAFASVAESFQMTWSMNLASELK + 2 Deamidated (NQ); Oxidation (M)
495 414.1881 1239.5426 1239.5554 -10.3 0 8 0.79 +1Score > 19 indicates identity MNTNIHQHVK + 3 Deamidated (NQ); Oxidation (M)
2097 549.2496 1096.4846 1096.4754 8.42 1 8 0.22 +1Score > 20 indicates identity
Score > 14 indicates homology		 CMRSLDGSR + Oxidation (M)
1309 481.7188 961.4231 961.4101 13.6 0 8 0.51 +1Score > 17 indicates identity NGATNVNNR + 3 Deamidated (NQ)
6103 873.3969 2617.1689 2617.1933 -9.31 0 8 0.79 +1Score > 19 indicates identity TDGATGAVSVPIQHASTFHQDSFDK + 2 Deamidated (NQ)
6296 886.9030 1771.7915 1771.8233 -18.0 0 8 0.53 +1Score > 17 indicates identity VNHQVMPDVSLVDMR + Deamidated (NQ); 2 Oxidation (M)
914 454.7066 907.3986 907.4069 -9.14 1 8 0.71 +1Score > 19 indicates identity TQERMNK + 2 Deamidated (NQ)
1498 495.2250 988.4354 988.4219 13.7 0 8 0.77 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
501 414.1881 1652.7235 1652.7406 -10.4 0 7 0.81 +1Score > 19 indicates identity FGFFEPHQIDMNR + Oxidation (M)
2320 562.7557 1123.4968 1123.5002 -3.00 0 7 0.58 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
4193 711.3232 1420.6319 1420.6218 7.10 1 7 0.86 +1Score > 19 indicates identity EPENQQAFRGSR + 3 Deamidated (NQ)
2247 562.7557 1123.4968 1123.5002 -3.00 0 7 0.59 +1Score > 18 indicates identity GMGIIGMEER + 2 Oxidation (M)
55 387.1759 772.3372 772.3464 -11.9 1 7 0.47 +1Score > 17 indicates identity RNDPDR + Deamidated (NQ)
193 400.6820 799.3495 799.3646 -19.0 0 7 0.4 +1Score > 16 indicates identity MEHINR + Deamidated (NQ)
1956 535.7434 2138.9445 2138.9716 -12.7 1 7 0.49 +1Score > 17 indicates identity GGASSNSFIDEGRLDDITER + Deamidated (NQ)
51 387.1759 772.3372 772.3248 16.1 0 7 0.49 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
5745 832.8785 1663.7424 1663.7577 -9.18 0 7 0.53 +1Score > 17 indicates identity APNNGDNVYLTIDQK + 3 Deamidated (NQ)
837 441.2004 1320.5795 1320.6058 -19.9 1 7 0.9 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
2107 549.2496 1096.4846 1096.4785 5.56 0 7 0.54 +1Score > 20 indicates identity
Score > 17 indicates homology		 YTNATDADAR
5055 778.8539 1555.6932 1555.7114 -11.7 1 7 0.69 +1Score > 18 indicates identity HSGENQEEQRLVK + 3 Deamidated (NQ)
1567 508.7311 2030.8955 2030.8891 3.12 0 7 0.44 +1Score > 16 indicates identity DEFGQLGTSFNEMAESLR + Deamidated (NQ)
2175 549.2496 1644.7269 1644.7090 10.9 0 7 1 +1Score > 20 indicates identity
Score > 20 indicates homology		 NSDFSITACTWTNK + Deamidated (NQ)
6382 886.9030 3543.5830 3543.6075 -6.92 0 7 0.57 +1Score > 17 indicates identity NGQWQMMTEPINYDRPVSGVGLAASFADAWSK + 2 Deamidated (NQ); Oxidation (M)
144 387.1759 1544.6744 1544.6487 16.6 1 7 0.5 +1Score > 17 indicates identity CSEFGDELIKNMS + Oxidation (M)
2124 549.2496 1096.4846 1096.5045 -18.2 0 7 0.3 +1Score > 20 indicates identity
Score > 15 indicates homology		 AFVVMMDPR + 2 Oxidation (M)
67 387.1759 1544.6744 1544.6824 -5.17 1 7 0.5 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
1452 495.2250 1482.6531 1482.6548 -1.13 0 7 0.84 +1Score > 19 indicates identity MNNIFLDNLQNK + 4 Deamidated (NQ); Oxidation (M)
3421 657.2986 1312.5827 1312.6043 -16.4 0 7 0.94 +1Score > 19 indicates identity MQSDLSYIMPK + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/