| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | test |
| MS data file | : | PRT1346_ENIGMA_14.mgf |
| Database | : | B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues) |
| Timestamp | : | 4 Dec 2025 at 15:32:34 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 7,621 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 562.7557 | 2246.9936 | 2246.9857 | 3.50 | 1 | 0 | 3.1 | 1Score > 18 indicates identity |
IGVMDYLNMKNIDADTDMR + Deamidated (NQ); 2 Oxidation (M) | |
| 576.2618 | 2301.0183 | 2301.0140 | 1.83 | 0 | 0 | 4.8 | 1Score > 20 indicates identity |
TGVSMNDVMQLANSLQNANFK + 4 Deamidated (NQ); Oxidation (M) | |
| 657.2986 | 2625.1655 | 2625.1408 | 9.40 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ) | |
| 684.3109 | 2733.2145 | 2733.2690 | -19.9 | 1 | 0 | 4.6 | 1Score > 19 indicates identity |
KSNQETIGAIYVVASMDNVYNQIR + 5 Deamidated (NQ); Oxidation (M) | |
| 765.3478 | 3057.3620 | 3057.3823 | -6.64 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 927.4214 | 2779.2425 | 2779.2218 | 7.47 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
SHSDTEVLLHSYMEWKEECIDR + Oxidation (M) | |
| 954.4337 | 2860.2793 | 2860.3212 | -14.6 | 0 | 0 | 4 | 1Score > 19 indicates identity |
QLIGSQFFNQVQQTMNINLTDLASK + 7 Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 1544.6744 | 1544.7028 | -18.4 | 0 | 0 | 2.5 | 1Score > 17 indicates identity |
TQEMLEHELEASK + Deamidated (NQ) | |
| 441.2004 | 1760.7727 | 1760.8006 | -15.9 | 0 | 0 | 4.6 | 1Score > 19 indicates identity |
SVNPPDDSWVAFANNK + Deamidated (NQ) | |
| 724.8293 | 1447.6441 | 1447.6474 | -2.23 | 1 | 0 | 2.9 | 1Score > 17 indicates identity |
NVNDRMNVTDNR + Deamidated (NQ) | |
| 913.9153 | 1825.8160 | 1825.8482 | -17.6 | 0 | 0 | 3.7 | 1Score > 18 indicates identity |
NLEQTYQDHLVQAHK + 3 Deamidated (NQ) | |
| 522.2372 | 2084.9199 | 2084.9361 | -7.77 | 0 | 0 | 4.5 | 1Score > 19 indicates identity |
SDNCEDTPEAGYFAIAVVK | |
| 616.7802 | 2463.0917 | 2463.1322 | -16.4 | 0 | 0 | 3 | 1Score > 17 indicates identity |
LVALDMDGTLLNDEQTISDENR + 2 Deamidated (NQ) | |
| 832.8785 | 3327.4848 | 3327.4985 | -4.12 | 0 | 0 | 2.8 | 1Score > 17 indicates identity |
TGEMDQVMALENGGDDFITKPFHAEIVMAK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 846.3846 | 3381.5092 | 3381.4581 | 15.1 | 0 | 0 | 4 | 1Score > 19 indicates identity |
SLLDDGSFEEFNQDMMSENPLEFPGYLEK + Deamidated (NQ) | |
| 684.3109 | 2733.2145 | 2733.2625 | -17.6 | 1 | 0 | 4.7 | 1Score > 19 indicates identity |
LSQPDMMNFEEHIRDNISDVITK + 2 Deamidated (NQ) | |
| 711.3232 | 2130.9479 | 2130.9739 | -12.2 | 1 | 0 | 4.7 | 1Score > 19 indicates identity |
QESVQQKNISIMSSFSGSR + 3 Deamidated (NQ); Oxidation (M) | |
| 805.8662 | 3219.4357 | 3219.4185 | 5.35 | 0 | 0 | 3.9 | 1Score > 19 indicates identity |
AWMIVVEPSDASEIENLMTAGQYEDMIK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 954.4337 | 1906.8529 | 1906.8156 | 19.6 | 0 | 0 | 4 | 1Score > 19 indicates identity |
QDDWLFVQMGHNDASK + Deamidated (NQ); Oxidation (M) | |
| 441.2004 | 1760.7727 | 1760.7783 | -3.21 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
YAANMACLMTGDITTK + Deamidated (NQ) | |
| 549.2496 | 2192.9692 | 2192.9792 | -4.57 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 765.3478 | 3057.3620 | 3057.3181 | 14.4 | 0 | 0 | 4.8 | 1Score > 19 indicates identity |
EQLQFCLMIEAGAGMNTTEQFESLFK + 4 Deamidated (NQ); 2 Oxidation (M) | |
| 805.8662 | 1609.7179 | 1609.7471 | -18.1 | 1 | 0 | 3.9 | 1Score > 19 indicates identity |
AIYNNEVSQKGEEK + 2 Deamidated (NQ) | |
| 387.1759 | 1544.6744 | 1544.6995 | -16.2 | 0 | 0 | 2.5 | 1Score > 17 indicates identity |
DYTLSDNGSGFEIK | |
| 576.2618 | 1150.5091 | 1150.5142 | -4.42 | 0 | 0 | 4.9 | 1Score > 20 indicates identity |
DGQIADQFEK + Deamidated (NQ) | |
| 805.8662 | 1609.7179 | 1609.7431 | -15.7 | 0 | 0 | 3.9 | 1Score > 19 indicates identity |
NIQASAQSTGSTTVSR + 3 Deamidated (NQ) | |
| 400.6820 | 1598.6989 | 1598.6882 | 6.71 | 0 | 0 | 2.1 | 1Score > 16 indicates identity |
MANQNAQSSINEFK + 2 Deamidated (NQ); Oxidation (M) | |
| 508.7311 | 2030.8955 | 2030.9116 | -7.93 | 1 | 0 | 2.3 | 1Score > 16 indicates identity |
YHPNLTKEECEENVNR | |
| 522.2372 | 1563.6899 | 1563.6987 | -5.63 | 1 | 0 | 4.5 | 1Score > 19 indicates identity |
MNHENREQYTLK + 2 Deamidated (NQ) | |
| 562.7557 | 1123.4968 | 1123.5146 | -15.8 | 0 | 0 | 3.2 | 1Score > 18 indicates identity |
EDGSLDYIGR | |
| 846.3846 | 2536.1319 | 2536.1308 | 0.42 | 1 | 0 | 4 | 1Score > 19 indicates identity |
AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M) | |
| 913.9153 | 1825.8160 | 1825.8482 | -17.6 | 0 | 0 | 3.8 | 1Score > 18 indicates identity |
NLEQTYQDHLVQAHK + 3 Deamidated (NQ) | |
| 954.4337 | 2860.2793 | 2860.3259 | -16.3 | 0 | 0 | 4 | 1Score > 19 indicates identity |
FVASQMAPATLDTMSVDLENNGLTFR + Deamidated (NQ); 2 Oxidation (M) | |
| 427.6943 | 1706.7481 | 1706.7677 | -11.5 | 1 | 0 | 2.1 | 1Score > 16 indicates identity |
EQAAVEHMLMEMKK + Deamidated (NQ); 2 Oxidation (M) | |
| 549.2496 | 2192.9692 | 2192.9792 | -4.57 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 576.2618 | 1150.5091 | 1150.5077 | 1.25 | 0 | 0 | 4.9 | 1Score > 20 indicates identity |
NMGDPLFANR + Deamidated (NQ); Oxidation (M) | |
| 832.8785 | 3327.4848 | 3327.5123 | -8.25 | 1 | 0 | 2.8 | 1Score > 17 indicates identity |
SQVEASAGDTPVQVIDMRDYGTMNGEAVLQK + 3 Deamidated (NQ); Oxidation (M) | |
| 900.4092 | 1798.8038 | 1798.7906 | 7.36 | 1 | 0 | 4.1 | 1Score > 19 indicates identity |
AYQEVYSRYMDVMK + Deamidated (NQ); Oxidation (M) | |
| 940.9276 | 3759.6811 | 3759.6556 | 6.78 | 0 | 0 | 2.7 | 1Score > 17 indicates identity |
YADLNQLCLSPQCGFASTEEGNLLTEEQQWEK + 2 Deamidated (NQ) | |
| 441.2004 | 1320.5795 | 1320.5867 | -5.48 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
EAQDTIGSQMPK + Deamidated (NQ); Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9468 | -12.9 | 0 | 0 | 4.6 | 1Score > 19 indicates identity |
EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M) | |
| 562.7557 | 2246.9936 | 2247.0300 | -16.2 | 1 | 0 | 3.2 | 1Score > 18 indicates identity |
DAWANLGGHMSVKMTEEEVK + Oxidation (M) | |
| 643.7925 | 2571.1411 | 2571.1340 | 2.75 | 1 | 0 | 3.1 | 1Score > 18 indicates identity |
RIHMMMAFPSVYTYMLEEMK + 4 Oxidation (M) | |
| 616.7802 | 1231.5459 | 1231.5680 | -18.0 | 0 | 0 | 3 | 1Score > 17 indicates identity |
GDAENGESVNIK | |
| 765.3478 | 2293.0215 | 2293.0606 | -17.1 | 1 | 0 | 4.8 | 1Score > 19 indicates identity |
KEVDGVMLCSLENEWEDIK | |
| 765.3478 | 3057.3620 | 3057.4025 | -13.3 | 1 | 0 | 4.8 | 1Score > 19 indicates identity |
LNFSVLNFANNHAMDYGEDGLKDTLNK + 2 Deamidated (NQ); Oxidation (M) | |
| 846.3846 | 2536.1319 | 2536.1308 | 0.42 | 1 | 0 | 4 | 1Score > 19 indicates identity |
AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M) | |
| 967.9399 | 1933.8652 | 1933.8752 | -5.16 | 1 | 0 | 2.6 | 1Score > 17 indicates identity |
NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ) | |
| 387.1759 | 772.3372 | 772.3248 | 16.1 | 0 | 0 | 2.6 | 1Score > 17 indicates identity |
MNAYMK + Oxidation (M) | |
| 441.2004 | 1320.5795 | 1320.6058 | -19.9 | 1 | 0 | 4.7 | 1Score > 19 indicates identity |
SDASQAGRQPFR + 2 Deamidated (NQ) | |
| 468.2127 | 1868.8217 | 1868.8574 | -19.1 | 1 | 0 | 4.3 | 1Score > 19 indicates identity |
CEGIVLRTNDYGETNK + Deamidated (NQ) | |
| 630.2864 | 2517.1164 | 2517.1183 | -0.74 | 1 | 0 | 4.7 | 1Score > 19 indicates identity |
IEKAFQHGEEWEINGDENQIK + 4 Deamidated (NQ) | |
| 738.3355 | 2949.3129 | 2949.3662 | -18.0 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
INFTLDSRYNMPGISITTNSQNSTTR + 3 Deamidated (NQ); Oxidation (M) | |
| 751.8416 | 3003.3374 | 3003.3841 | -15.6 | 1 | 0 | 2.2 | 1Score > 16 indicates identity |
DRQQDLFLNDEISVMTATSAFGMGIDK + 2 Deamidated (NQ) | |
| 765.3478 | 2293.0215 | 2293.0572 | -15.6 | 1 | 0 | 4.8 | 1Score > 19 indicates identity |
MHQTNEWDVFKQEITELK + 2 Deamidated (NQ); Oxidation (M) | |
| 387.1759 | 1158.5058 | 1158.5049 | 0.74 | 0 | 0 | 2.6 | 1Score > 17 indicates identity |
SVMFGAMAEGK + 2 Oxidation (M) | |
| 454.7066 | 907.3986 | 907.4069 | -9.14 | 1 | 0 | 4 | 1Score > 19 indicates identity |
QRAMQEK + 2 Deamidated (NQ); Oxidation (M) | |
| 495.2250 | 1976.8708 | 1976.8608 | 5.07 | 1 | 0 | 4.3 | 1Score > 19 indicates identity |
MTQDEFYMKEAVNEAR + Oxidation (M) | |
| 522.2372 | 2084.9199 | 2084.9183 | 0.76 | 1 | 0 | 4.6 | 1Score > 19 indicates identity |
NTYFSNKNEMIFMISGR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 576.2618 | 2301.0183 | 2301.0623 | -19.1 | 0 | 0 | 4.9 | 1Score > 20 indicates identity |
SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ) | |
| 792.3600 | 3165.4111 | 3165.4713 | -19.0 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
NNWYLENEMSSIQGVLAGAPWVTSAENGK + Deamidated (NQ) | |
| 805.8662 | 1609.7179 | 1609.7327 | -9.22 | 1 | 0 | 4 | 1Score > 19 indicates identity |
SSKAMQALQPEMQK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 846.3846 | 2536.1319 | 2536.1308 | 0.42 | 1 | 0 | 4.1 | 1Score > 19 indicates identity |
AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M) | |
| 657.2986 | 1968.8741 | 1968.9099 | -18.2 | 0 | 0 | 4.9 | 1Score > 19 indicates identity |
DYSDNLDAMLLTALSGDR | |
| 724.8293 | 1447.6441 | 1447.6613 | -11.8 | 1 | 0 | 3 | 1Score > 17 indicates identity |
MDTQPEREQAVK + Deamidated (NQ); Oxidation (M) | |
| 468.2127 | 1401.6163 | 1401.6082 | 5.79 | 0 | 0 | 4.3 | 1Score > 19 indicates identity |
MTESQHDPAEIK + Deamidated (NQ); Oxidation (M) | |
| 616.7802 | 2463.0917 | 2463.0900 | 0.70 | 0 | 0 | 3 | 1Score > 17 indicates identity |
EIEFTAPGGYLGETYDQDGMVR + Oxidation (M) | |
| 792.3600 | 1582.7055 | 1582.7219 | -10.3 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MNTIGVCVSQITDK + 2 Deamidated (NQ); Oxidation (M) | |
| 913.9153 | 1825.8160 | 1825.8048 | 6.12 | 0 | 0 | 3.8 | 1Score > 18 indicates identity |
AVLNFMAMMENAVHAK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 400.6820 | 1598.6989 | 1598.6738 | 15.7 | 0 | 0 | 2.2 | 1Score > 16 indicates identity |
TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M) | |
| 468.2127 | 934.4109 | 934.4144 | -3.83 | 0 | 0 | 4.3 | 1Score > 19 indicates identity |
AAESDWTR | |
| 643.7925 | 1285.5705 | 1285.5570 | 10.5 | 0 | 0 | 3.2 | 1Score > 18 indicates identity |
MLEQMNFIDK + 2 Deamidated (NQ); Oxidation (M) | |
| 643.7925 | 2571.1411 | 2571.1340 | 2.75 | 1 | 0 | 3.2 | 1Score > 18 indicates identity |
RIHMMMAFPSVYTYMLEEMK + 4 Oxidation (M) | |
| 792.3600 | 3165.4111 | 3165.4284 | -5.47 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
YYHIYISDDPDMMQSVANFSRLGANSR + Oxidation (M) | |
| 873.3969 | 2617.1689 | 2617.2107 | -16.0 | 1 | 0 | 4.5 | 1Score > 19 indicates identity |
MMLNQKGASVINISSMSAQTPMTK + 2 Deamidated (NQ); 3 Oxidation (M) | |
| 900.4092 | 3597.6076 | 3597.5857 | 6.09 | 1 | 0 | 4.1 | 1Score > 19 indicates identity |
HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M) | |
| 454.7066 | 1814.7972 | 1814.8186 | -11.8 | 0 | 0 | 4 | 1Score > 19 indicates identity |
GTFTMVFDHYEEVPK + Oxidation (M) | |
| 522.2372 | 1563.6899 | 1563.6987 | -5.63 | 1 | 0 | 4.6 | 1Score > 19 indicates identity |
MNHENREQYTLK + 2 Deamidated (NQ) | |
| 616.7802 | 1231.5459 | 1231.5431 | 2.28 | 0 | 0 | 3 | 1Score > 17 indicates identity |
AAELFYMEDK + Oxidation (M) | |
| 711.3232 | 2841.2639 | 2841.2684 | -1.59 | 1 | 0 | 4.8 | 1Score > 19 indicates identity |
EGASGNCLYNVNLVKQLPLNSMENR + 6 Deamidated (NQ); Oxidation (M) | |
| 913.9153 | 3651.6320 | 3651.6226 | 2.59 | 1 | 0 | 3.8 | 1Score > 18 indicates identity |
MDANQMNEQINKMSQSISSLQSLLSQFSGGSQK + 4 Deamidated (NQ); 2 Oxidation (M) | |
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
| 387.1759 | 772.3372 | ||||||||
Not what you expected? Try
the select summary.