MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1501–1600 (out of 7572)


Page: Previous 1 11 12 13 14 15 16 17 18 19 20 21  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2277 562.7557 2246.9936 2246.9857 3.50 1 0 3.1 +1Score > 18 indicates identity IGVMDYLNMKNIDADTDMR + Deamidated (NQ); 2 Oxidation (M)
2526 576.2618 2301.0183 2301.0140 1.83 0 0 4.8 +1Score > 20 indicates identity TGVSMNDVMQLANSLQNANFK + 4 Deamidated (NQ); Oxidation (M)
3435 657.2986 2625.1655 2625.1408 9.40 0 0 4.7 +1Score > 19 indicates identity DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ)
3760 684.3109 2733.2145 2733.2690 -19.9 1 0 4.6 +1Score > 19 indicates identity KSNQETIGAIYVVASMDNVYNQIR + 5 Deamidated (NQ); Oxidation (M)
4860 765.3478 3057.3620 3057.3823 -6.64 0 0 4.7 +1Score > 19 indicates identity LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M)
6837 927.4214 2779.2425 2779.2218 7.47 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SHSDTEVLLHSYMEWKEECIDR + Oxidation (M)
7194 954.4337 2860.2793 2860.3212 -14.6 0 0 4 +1Score > 19 indicates identity QLIGSQFFNQVQQTMNINLTDLASK + 7 Deamidated (NQ); Oxidation (M)
121 387.1759 1544.6744 1544.7028 -18.4 0 0 2.5 +1Score > 17 indicates identity TQEMLEHELEASK + Deamidated (NQ)
805 441.2004 1760.7727 1760.8006 -15.9 0 0 4.6 +1Score > 19 indicates identity SVNPPDDSWVAFANNK + Deamidated (NQ)
4364 724.8293 1447.6441 1447.6474 -2.23 1 0 2.9 +1Score > 17 indicates identity NVNDRMNVTDNR + Deamidated (NQ)
6670 913.9153 1825.8160 1825.8482 -17.6 0 0 3.7 +1Score > 18 indicates identity NLEQTYQDHLVQAHK + 3 Deamidated (NQ)
1813 522.2372 2084.9199 2084.9361 -7.77 0 0 4.5 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
3020 616.7802 2463.0917 2463.1322 -16.4 0 0 3 +1Score > 17 indicates identity LVALDMDGTLLNDEQTISDENR + 2 Deamidated (NQ)
5670 832.8785 3327.4848 3327.4985 -4.12 0 0 2.8 +1Score > 17 indicates identity TGEMDQVMALENGGDDFITKPFHAEIVMAK + 2 Deamidated (NQ); 2 Oxidation (M)
5811 846.3846 3381.5092 3381.4581 15.1 0 0 4 +1Score > 19 indicates identity SLLDDGSFEEFNQDMMSENPLEFPGYLEK + Deamidated (NQ)
3873 684.3109 2733.2145 2733.2625 -17.6 1 0 4.7 +1Score > 19 indicates identity LSQPDMMNFEEHIRDNISDVITK + 2 Deamidated (NQ)
4143 711.3232 2130.9479 2130.9739 -12.2 1 0 4.7 +1Score > 19 indicates identity QESVQQKNISIMSSFSGSR + 3 Deamidated (NQ); Oxidation (M)
5380 805.8662 3219.4357 3219.4185 5.35 0 0 3.9 +1Score > 19 indicates identity AWMIVVEPSDASEIENLMTAGQYEDMIK + 2 Deamidated (NQ); 3 Oxidation (M)
7192 954.4337 1906.8529 1906.8156 19.6 0 0 4 +1Score > 19 indicates identity QDDWLFVQMGHNDASK + Deamidated (NQ); Oxidation (M)
812 441.2004 1760.7727 1760.7783 -3.21 0 0 4.7 +1Score > 19 indicates identity YAANMACLMTGDITTK + Deamidated (NQ)
2093 549.2496 2192.9692 2192.9792 -4.57 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M)
4800 765.3478 3057.3620 3057.3181 14.4 0 0 4.8 +1Score > 19 indicates identity EQLQFCLMIEAGAGMNTTEQFESLFK + 4 Deamidated (NQ); 2 Oxidation (M)
5362 805.8662 1609.7179 1609.7471 -18.1 1 0 3.9 +1Score > 19 indicates identity AIYNNEVSQKGEEK + 2 Deamidated (NQ)
93 387.1759 1544.6744 1544.6995 -16.2 0 0 2.5 +1Score > 17 indicates identity DYTLSDNGSGFEIK
2522 576.2618 1150.5091 1150.5142 -4.42 0 0 4.9 +1Score > 20 indicates identity DGQIADQFEK + Deamidated (NQ)
5276 805.8662 1609.7179 1609.7431 -15.7 0 0 3.9 +1Score > 19 indicates identity NIQASAQSTGSTTVSR + 3 Deamidated (NQ)
328 400.6820 1598.6989 1598.6882 6.71 0 0 2.1 +1Score > 16 indicates identity MANQNAQSSINEFK + 2 Deamidated (NQ); Oxidation (M)
1582 508.7311 2030.8955 2030.9116 -7.93 1 0 2.3 +1Score > 16 indicates identity YHPNLTKEECEENVNR
1722 522.2372 1563.6899 1563.6987 -5.63 1 0 4.5 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
2329 562.7557 1123.4968 1123.5146 -15.8 0 0 3.2 +1Score > 18 indicates identity EDGSLDYIGR
5797 846.3846 2536.1319 2536.1308 0.42 1 0 4 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
6774 913.9153 1825.8160 1825.8482 -17.6 0 0 3.8 +1Score > 18 indicates identity NLEQTYQDHLVQAHK + 3 Deamidated (NQ)
7190 954.4337 2860.2793 2860.3259 -16.3 0 0 4 +1Score > 19 indicates identity FVASQMAPATLDTMSVDLENNGLTFR + Deamidated (NQ); 2 Oxidation (M)
650 427.6943 1706.7481 1706.7677 -11.5 1 0 2.1 +1Score > 16 indicates identity EQAAVEHMLMEMKK + Deamidated (NQ); 2 Oxidation (M)
2076 549.2496 2192.9692 2192.9792 -4.57 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NPGVMVMMNPFQPASVPAEK + 2 Deamidated (NQ); 3 Oxidation (M)
2489 576.2618 1150.5091 1150.5077 1.25 0 0 4.9 +1Score > 20 indicates identity NMGDPLFANR + Deamidated (NQ); Oxidation (M)
5718 832.8785 3327.4848 3327.5123 -8.25 1 0 2.8 +1Score > 17 indicates identity SQVEASAGDTPVQVIDMRDYGTMNGEAVLQK + 3 Deamidated (NQ); Oxidation (M)
6496 900.4092 1798.8038 1798.7906 7.36 1 0 4.1 +1Score > 19 indicates identity AYQEVYSRYMDVMK + Deamidated (NQ); Oxidation (M)
7040 940.9276 3759.6811 3759.6556 6.78 0 0 2.7 +1Score > 17 indicates identity YADLNQLCLSPQCGFASTEEGNLLTEEQQWEK + 2 Deamidated (NQ)
765 441.2004 1320.5795 1320.5867 -5.48 0 0 4.7 +1Score > 19 indicates identity EAQDTIGSQMPK + Deamidated (NQ); Oxidation (M)
1868 522.2372 2084.9199 2084.9468 -12.9 0 0 4.6 +1Score > 19 indicates identity EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M)
2296 562.7557 2246.9936 2247.0300 -16.2 1 0 3.2 +1Score > 18 indicates identity DAWANLGGHMSVKMTEEEVK + Oxidation (M)
3374 643.7925 2571.1411 2571.1340 2.75 1 0 3.1 +1Score > 18 indicates identity RIHMMMAFPSVYTYMLEEMK + 4 Oxidation (M)
2974 616.7802 1231.5459 1231.5680 -18.0 0 0 3 +1Score > 17 indicates identity GDAENGESVNIK
4799 765.3478 2293.0215 2293.0606 -17.1 1 0 4.8 +1Score > 19 indicates identity KEVDGVMLCSLENEWEDIK
4907 765.3478 3057.3620 3057.4025 -13.3 1 0 4.8 +1Score > 19 indicates identity LNFSVLNFANNHAMDYGEDGLKDTLNK + 2 Deamidated (NQ); Oxidation (M)
5922 846.3846 2536.1319 2536.1308 0.42 1 0 4 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
7301 967.9399 1933.8652 1933.8752 -5.16 1 0 2.6 +1Score > 17 indicates identity NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ)
84 387.1759 772.3372 772.3248 16.1 0 0 2.6 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
779 441.2004 1320.5795 1320.6058 -19.9 1 0 4.7 +1Score > 19 indicates identity SDASQAGRQPFR + 2 Deamidated (NQ)
1188 468.2127 1868.8217 1868.8574 -19.1 1 0 4.3 +1Score > 19 indicates identity CEGIVLRTNDYGETNK + Deamidated (NQ)
3094 630.2864 2517.1164 2517.1183 -0.74 1 0 4.7 +1Score > 19 indicates identity IEKAFQHGEEWEINGDENQIK + 4 Deamidated (NQ)
4443 738.3355 2949.3129 2949.3662 -18.0 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
INFTLDSRYNMPGISITTNSQNSTTR + 3 Deamidated (NQ); Oxidation (M)
4704 751.8416 3003.3374 3003.3841 -15.6 1 0 2.2 +1Score > 16 indicates identity DRQQDLFLNDEISVMTATSAFGMGIDK + 2 Deamidated (NQ)
4875 765.3478 2293.0215 2293.0572 -15.6 1 0 4.8 +1Score > 19 indicates identity MHQTNEWDVFKQEITELK + 2 Deamidated (NQ); Oxidation (M)
90 387.1759 1158.5058 1158.5049 0.74 0 0 2.6 +1Score > 17 indicates identity SVMFGAMAEGK + 2 Oxidation (M)
876 454.7066 907.3986 907.4069 -9.14 1 0 4 +1Score > 19 indicates identity QRAMQEK + 2 Deamidated (NQ); Oxidation (M)
1485 495.2250 1976.8708 1976.8608 5.07 1 0 4.3 +1Score > 19 indicates identity MTQDEFYMKEAVNEAR + Oxidation (M)
1798 522.2372 2084.9199 2084.9183 0.76 1 0 4.6 +1Score > 19 indicates identity NTYFSNKNEMIFMISGR + 2 Deamidated (NQ); 2 Oxidation (M)
2515 576.2618 2301.0183 2301.0623 -19.1 0 0 4.9 +1Score > 20 indicates identity SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ)
5133 792.3600 3165.4111 3165.4713 -19.0 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
NNWYLENEMSSIQGVLAGAPWVTSAENGK + Deamidated (NQ)
5278 805.8662 1609.7179 1609.7327 -9.22 1 0 4 +1Score > 19 indicates identity SSKAMQALQPEMQK + 2 Deamidated (NQ); 2 Oxidation (M)
5801 846.3846 2536.1319 2536.1308 0.42 1 0 4.1 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
3551 657.2986 1968.8741 1968.9099 -18.2 0 0 4.9 +1Score > 19 indicates identity DYSDNLDAMLLTALSGDR
4303 724.8293 1447.6441 1447.6613 -11.8 1 0 3 +1Score > 17 indicates identity MDTQPEREQAVK + Deamidated (NQ); Oxidation (M)
1169 468.2127 1401.6163 1401.6082 5.79 0 0 4.3 +1Score > 19 indicates identity MTESQHDPAEIK + Deamidated (NQ); Oxidation (M)
2986 616.7802 2463.0917 2463.0900 0.70 0 0 3 +1Score > 17 indicates identity EIEFTAPGGYLGETYDQDGMVR + Oxidation (M)
5210 792.3600 1582.7055 1582.7219 -10.3 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNTIGVCVSQITDK + 2 Deamidated (NQ); Oxidation (M)
6630 913.9153 1825.8160 1825.8048 6.12 0 0 3.8 +1Score > 18 indicates identity AVLNFMAMMENAVHAK + 2 Deamidated (NQ); 3 Oxidation (M)
314 400.6820 1598.6989 1598.6738 15.7 0 0 2.2 +1Score > 16 indicates identity TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M)
1133 468.2127 934.4109 934.4144 -3.83 0 0 4.3 +1Score > 19 indicates identity AAESDWTR
3358 643.7925 1285.5705 1285.5570 10.5 0 0 3.2 +1Score > 18 indicates identity MLEQMNFIDK + 2 Deamidated (NQ); Oxidation (M)
3361 643.7925 2571.1411 2571.1340 2.75 1 0 3.2 +1Score > 18 indicates identity RIHMMMAFPSVYTYMLEEMK + 4 Oxidation (M)
5187 792.3600 3165.4111 3165.4284 -5.47 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
YYHIYISDDPDMMQSVANFSRLGANSR + Oxidation (M)
6153 873.3969 2617.1689 2617.2107 -16.0 1 0 4.5 +1Score > 19 indicates identity MMLNQKGASVINISSMSAQTPMTK + 2 Deamidated (NQ); 3 Oxidation (M)
6511 900.4092 3597.6076 3597.5857 6.09 1 0 4.1 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
881 454.7066 1814.7972 1814.8186 -11.8 0 0 4 +1Score > 19 indicates identity GTFTMVFDHYEEVPK + Oxidation (M)
1737 522.2372 1563.6899 1563.6987 -5.63 1 0 4.6 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
2977 616.7802 1231.5459 1231.5431 2.28 0 0 3 +1Score > 17 indicates identity AAELFYMEDK + Oxidation (M)
4198 711.3232 2841.2639 2841.2684 -1.59 1 0 4.8 +1Score > 19 indicates identity EGASGNCLYNVNLVKQLPLNSMENR + 6 Deamidated (NQ); Oxidation (M)
6738 913.9153 3651.6320 3651.6226 2.59 1 0 3.8 +1Score > 18 indicates identity MDANQMNEQINKMSQSISSLQSLLSQFSGGSQK + 4 Deamidated (NQ); 2 Oxidation (M)
1 387.1759 772.3372
2 387.1759 772.3372
3 387.1759 772.3372
4 387.1759 772.3372
5 387.1759 772.3372
6 387.1759 772.3372
7 387.1759 772.3372
8 387.1759 772.3372
9 387.1759 772.3372
10 387.1759 772.3372
11 387.1759 772.3372
12 387.1759 772.3372
13 387.1759 772.3372
14 387.1759 772.3372
15 387.1759 772.3372
16 387.1759 772.3372
17 387.1759 772.3372
18 387.1759 772.3372
33 387.1759 772.3372
Page: Previous 1 11 12 13 14 15 16 17 18 19 20 21  76 Next 

Not what you expected? Try the select summary.