MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1401–1500 (out of 7572)


Page: Previous 1 10 11 12 13 14 15 16 17 18 19 20  76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
5967 859.8907 3435.5339 3435.5805 -13.6 0 0 2.2 +1Score > 16 indicates identity AHTAPYELWGQVGNGALDHAWWGPAEVMPMK + Deamidated (NQ); Oxidation (M)
6548 900.4092 3597.6076 3597.5857 6.09 1 0 3.7 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
6956 940.9276 3759.6811 3759.6556 6.78 0 0 2.5 +1Score > 17 indicates identity YADLNQLCLSPQCGFASTEEGNLLTEEQQWEK + 2 Deamidated (NQ)
2151 549.2496 2192.9692 2192.9644 2.18 1 0 0.96 +1Score > 20 indicates identity
Score > 13 indicates homology
WSRLNQDESIDVPDDMTR + Deamidated (NQ); Oxidation (M)
2704 589.7679 2355.0427 2355.0246 7.68 0 0 2.7 +1Score > 17 indicates identity VDAFNQMEGIMNELNDTGLNK + 3 Deamidated (NQ)
3458 657.2986 2625.1655 2625.1634 0.78 0 0 4.4 +1Score > 19 indicates identity LWLGWMSNWQYANDVPTSPWR + 3 Deamidated (NQ); Oxidation (M)
5286 805.8662 3219.4357 3219.4864 -15.7 0 0 3.7 +1Score > 19 indicates identity VDTQSNENSQTTPSTPGQLALANMLVEELK + 5 Deamidated (NQ)
7549 980.1954 3916.7526 3916.6754 19.7 0 0 2 +1Score > 16 indicates identity GCTYDDIANAILFYASDQASYMTGQSINVTGGQVMH + 3 Deamidated (NQ); Oxidation (M)
116 387.1759 1544.6744 1544.6599 9.38 1 0 2.4 +1Score > 17 indicates identity YNEMQEKGMSQGK + Oxidation (M)
1913 535.7434 2138.9445 2138.9765 -14.9 0 0 2.4 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
2808 603.2741 1204.5337 1204.5434 -8.08 1 0 4.1 +1Score > 19 indicates identity MKYTFNEEK + Oxidation (M)
3186 630.2864 2517.1164 2517.1442 -11.0 1 0 4.3 +1Score > 19 indicates identity NNESNFLMYQTENGDTKIQVR + Deamidated (NQ); Oxidation (M)
3807 684.3109 2049.9109 2049.9392 -13.8 1 0 4.3 +1Score > 19 indicates identity RYGFIHVDQDDDGNGTLK + Deamidated (NQ)
7204 954.4337 2860.2793 2860.2848 -1.91 1 0 3.7 +1Score > 19 indicates identity SVPNLDPKNIVIMDQNSTYYDQTGK + 5 Deamidated (NQ); Oxidation (M)
7493 980.1954 3916.7526 3916.8286 -19.4 1 0 2 +1Score > 16 indicates identity QLEQENAELESRIQEASHSQVLTMTPDYQSHFR + Oxidation (M)
2187 549.2496 2192.9692 2192.9619 3.32 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DGHQIGSMGYAYKNYSQMK + Oxidation (M)
1205 481.7188 1922.8463 1922.8469 -0.32 1 0 2.6 +1Score > 17 indicates identity GKEGFYQGFVNSMATGGR + 2 Deamidated (NQ); Oxidation (M)
3174 630.2864 1258.5582 1258.5798 -17.2 0 0 4.4 +1Score > 19 indicates identity MNLEHPMVTR + 2 Oxidation (M)
4789 765.3478 2293.0215 2293.0359 -6.29 0 0 4.5 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
1308 481.7188 961.4231 961.4352 -12.6 1 0 2.6 +1Score > 17 indicates identity DAGDQKAEK + Deamidated (NQ)
1892 535.7434 2138.9445 2138.9765 -14.9 0 0 2.5 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
1972 535.7434 2138.9445 2138.9758 -14.6 0 0 2.5 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
5896 846.3846 3381.5092 3381.5598 -15.0 1 0 3.7 +1Score > 19 indicates identity NEPIGVGKDGQNVYFNDIWPTMDEINSVVK + 4 Deamidated (NQ)
6760 913.9153 1825.8160 1825.8152 0.44 1 0 3.5 +1Score > 18 indicates identity QDGSLDYMGRADQQIK + 2 Deamidated (NQ)
7161 954.4337 2860.2793 2860.3292 -17.5 0 0 3.7 +1Score > 19 indicates identity DMIVILNDNEMSIAPNVGAIHSMLGR + 3 Deamidated (NQ); 3 Oxidation (M)
1320 481.7188 961.4231 961.4287 -5.77 0 0 2.7 +1Score > 17 indicates identity ANEMNLNR + Deamidated (NQ)
1464 495.2250 1976.8708 1976.8786 -3.92 0 0 4 +1Score > 19 indicates identity DNMTVIWLGNNGSPQDAK + 2 Deamidated (NQ); Oxidation (M)
3508 657.2986 1312.5827 1312.5643 14.0 0 0 4.5 +1Score > 19 indicates identity ENGHEQAAETAR + Deamidated (NQ)
2789 603.2741 2409.0673 2409.0688 -0.62 0 0 4.1 +1Score > 19 indicates identity NYIFSYINEHPEQFYSDLK + 3 Deamidated (NQ)
4071 697.8171 1393.6196 1393.6473 -19.9 0 0 2.9 +1Score > 17 indicates identity QSTQEELANAFR + Deamidated (NQ)
2105 549.2496 1644.7269 1644.7572 -18.5 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WYVVHTYSGYENK
2176 549.2496 1644.7269 1644.7561 -17.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNETLQQYMMLVK + Deamidated (NQ); Oxidation (M)
5270 805.8662 1609.7179 1609.7431 -15.7 0 0 3.7 +1Score > 19 indicates identity NIQASAQSTGSTTVSR + 3 Deamidated (NQ)
1019 454.7066 907.3986 907.4035 -5.46 0 0 3.7 +1Score > 19 indicates identity NDIDFQR + Deamidated (NQ)
2197 549.2496 2192.9692 2192.9432 11.8 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SENAYNSMYKTLANHNYR + 2 Deamidated (NQ); Oxidation (M)
5028 778.8539 3111.3864 3111.3592 8.75 0 0 3.4 +1Score > 18 indicates identity TSPIAWDMNCLEEVCGACSMVINGKPR + Deamidated (NQ); Oxidation (M)
6518 900.4092 3597.6076 3597.5857 6.09 1 0 3.8 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
7165 954.4337 2860.2793 2860.3292 -17.5 0 0 3.8 +1Score > 19 indicates identity DMIVILNDNEMSIAPNVGAIHSMLGR + 3 Deamidated (NQ); 3 Oxidation (M)
1162 468.2127 1868.8217 1868.8574 -19.1 1 0 4 +1Score > 19 indicates identity CEGIVLRTNDYGETNK + Deamidated (NQ)
1461 495.2250 1976.8708 1976.8716 -0.38 0 0 4 +1Score > 19 indicates identity IMMEINPTIAYTMMDR + 3 Oxidation (M)
3932 697.8171 2787.2392 2787.2414 -0.78 0 0 2.9 +1Score > 17 indicates identity EFVGSHMIYTYENGWEYEIYIK + Deamidated (NQ); Oxidation (M)
4216 711.3232 2841.2639 2841.2810 -6.03 1 0 4.4 +1Score > 19 indicates identity QAGYQMAVTTEPGAASRDQGMYALHR + Deamidated (NQ); 2 Oxidation (M)
4769 765.3478 2293.0215 2293.0359 -6.29 0 0 4.5 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
6836 927.4214 1852.8283 1852.8414 -7.04 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WSGIHMTPEQSVQAHK + 2 Deamidated (NQ); Oxidation (M)
261 400.6820 1598.6989 1598.7280 -18.2 1 0 2 +1Score > 16 indicates identity DMVESMSATAERIK + 2 Oxidation (M)
835 441.2004 1760.7727 1760.7828 -5.78 1 0 4.4 +1Score > 19 indicates identity WAMGFAGEGTNDSKFK + Oxidation (M)
2566 589.7679 2355.0427 2355.0365 2.63 1 0 2.7 +1Score > 17 indicates identity TYDEKGVFYNSIGEYPNAMR + 2 Deamidated (NQ)
167 387.1759 1544.6744 1544.6673 4.60 0 0 2.4 +1Score > 17 indicates identity EQMMYDMEALLR + Oxidation (M)
2375 562.7557 1123.4968 1123.5008 -3.60 0 0 3 +1Score > 18 indicates identity GMYGFTGTYK
3091 630.2864 2517.1164 2517.1183 -0.74 1 0 4.4 +1Score > 19 indicates identity IEKAFQHGEEWEINGDENQIK + 4 Deamidated (NQ)
38 387.1759 1158.5058 1158.5193 -11.6 0 0 2.4 +1Score > 17 indicates identity NSTAFAADYAK + Deamidated (NQ)
1770 522.2372 1563.6899 1563.6736 10.4 1 0 4.3 +1Score > 19 indicates identity MVANEEDGWRNAR + Deamidated (NQ); Oxidation (M)
2498 576.2618 2301.0183 2301.0252 -3.03 1 0 4.6 +1Score > 20 indicates identity NAKTQSLACVASYEAMANNEK + 2 Deamidated (NQ)
2968 616.7802 2463.0917 2463.0900 0.70 0 0 2.8 +1Score > 17 indicates identity EIEFTAPGGYLGETYDQDGMVR + Oxidation (M)
5498 819.3723 1636.7301 1636.7468 -10.2 0 0 4.6 +1Score > 20 indicates identity EIIDTIEDQGYDVAG
6829 927.4214 1852.8283 1852.8414 -7.05 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
KPSMGTHFSEVNDNFK + Oxidation (M)
488 414.1881 1239.5426 1239.5666 -19.3 1 0 4.2 +1Score > 19 indicates identity NARNMAYVQR + 2 Deamidated (NQ); Oxidation (M)
3923 697.8171 1393.6196 1393.6222 -1.85 1 0 2.9 +1Score > 17 indicates identity ESAEEFRNQGAR + Deamidated (NQ)
260 400.6820 1598.6989 1598.7286 -18.6 0 0 2.1 +1Score > 16 indicates identity MYAEVFAGLNEDPK + Oxidation (M)
629 427.6943 1706.7481 1706.7675 -11.4 0 0 2 +1Score > 16 indicates identity ASFYLYNTEEDIDK
3645 670.8048 1339.5951 1339.6078 -9.51 0 0 3.5 +1Score > 18 indicates identity MEDIIFAGSDSR
4926 778.8539 3111.3864 3111.4481 -19.8 1 0 3.4 +1Score > 18 indicates identity EYMITAEGQKALQSWLEEPINDIASEK + 3 Deamidated (NQ); Oxidation (M)
123 387.1759 1158.5058 1158.5265 -17.9 0 0 2.4 +1Score > 17 indicates identity QQLDAANQNR + 2 Deamidated (NQ)
1564 508.7311 2030.8955 2030.8891 3.12 0 0 2.2 +1Score > 16 indicates identity DEFGQLGTSFNEMAESLR + Deamidated (NQ)
1695 508.7311 2030.8955 2030.8891 3.12 0 0 2.2 +1Score > 16 indicates identity DEFGQLGTSFNEMAESLR + Deamidated (NQ)
3290 643.7925 2571.1411 2571.1648 -9.22 0 0 3 +1Score > 18 indicates identity EIYQDIPVLNMYLPEEDQMTK + 3 Deamidated (NQ)
4453 738.3355 2211.9847 2212.0192 -15.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GSVMNPNDHPHGGGEGRAPIGR + Deamidated (NQ)
6863 927.4214 1852.8283 1852.8261 1.20 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SSIEVFANHGEATMTSR + Deamidated (NQ); Oxidation (M)
557 427.6943 1706.7481 1706.7496 -0.85 0 0 2 +1Score > 16 indicates identity GAAGDNGIYNQDLNER + Deamidated (NQ)
1891 535.7434 1069.4723 1069.4750 -2.55 1 0 2.6 +1Score > 17 indicates identity MDQFKQEK + Deamidated (NQ); Oxidation (M)
2275 562.7557 2246.9936 2247.0114 -7.91 1 0 3.1 +1Score > 18 indicates identity SKDEFGQLGTSFNEMADSLR + Oxidation (M)
4262 724.8293 1447.6441 1447.6613 -11.8 1 0 2.8 +1Score > 17 indicates identity MDTQPEREQAVK + Deamidated (NQ); Oxidation (M)
7393 967.9399 1933.8652 1933.8959 -15.9 1 0 2.5 +1Score > 17 indicates identity FGSFDQFKEDFAAAAAGR
211 400.6820 1598.6989 1598.6812 11.1 0 0 2.1 +1Score > 16 indicates identity MLMQVMQDPEMAK + 3 Oxidation (M)
1766 522.2372 1563.6899 1563.6987 -5.63 1 0 4.4 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
2410 576.2618 1725.7637 1725.7662 -1.43 1 0 4.7 +1Score > 20 indicates identity SDNLKSQMQDIMSGR + Deamidated (NQ); Oxidation (M)
326 400.6820 1598.6989 1598.7102 -7.07 1 0 2.1 +1Score > 16 indicates identity EMNTLVGMEEMKR + 2 Oxidation (M)
1561 508.7311 2030.8955 2030.9215 -12.8 1 0 2.2 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
5571 819.3723 2455.0951 2455.1002 -2.06 0 0 4.8 +1Score > 20 indicates identity NVFMFLEPGESPNYPEGIQDR + Deamidated (NQ); Oxidation (M)
5697 832.8785 1663.7424 1663.7424 -0.0060 1 0 2.7 +1Score > 17 indicates identity DGKAESLDLESEDQK + Deamidated (NQ)
804 441.2004 880.3863 880.3709 17.6 0 0 4.6 +1Score > 19 indicates identity MTSNQQR + Deamidated (NQ); Oxidation (M)
2462 576.2618 1725.7637 1725.7855 -12.6 0 0 4.8 +1Score > 20 indicates identity AWCYVDDMIDGILR
4132 711.3232 2841.2639 2841.2810 -6.03 1 0 4.6 +1Score > 19 indicates identity QAGYQMAVTTEPGAASRDQGMYALHR + Deamidated (NQ); 2 Oxidation (M)
4432 738.3355 2211.9847 2212.0028 -8.16 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MDNQELTMPTKYDPSAVEK + Oxidation (M)
5041 778.8539 1555.6932 1555.7188 -16.4 1 0 3.5 +1Score > 18 indicates identity YKNGELSESEMLR + Deamidated (NQ)
7514 980.1954 2937.5645 2937.5083 19.1 1 0 2.1 +1Score > 16 indicates identity YAKPEEVASTIVYLASEKAAAINGSAQR + Deamidated (NQ)
1637 508.7311 2030.8955 2030.8898 2.77 0 0 2.2 +1Score > 16 indicates identity QVAEACGGGGGGRPDMAQAGGK + Deamidated (NQ)
2969 616.7802 1231.5459 1231.5680 -18.0 0 0 2.9 +1Score > 17 indicates identity GDAENGESVNIK
5485 819.3723 2455.0951 2455.1002 -2.06 0 0 4.8 +1Score > 20 indicates identity NVFMFLEPGESPNYPEGIQDR + Deamidated (NQ); Oxidation (M)
6363 886.9030 1771.7915 1771.8120 -11.6 1 0 2.9 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
300 400.6820 1598.6989 1598.6738 15.7 0 0 2.1 +1Score > 16 indicates identity TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M)
7310 967.9399 3867.7304 3867.7421 -3.03 0 0 2.5 +1Score > 17 indicates identity DEQGNYVMGTEPVDVQGLLEEADGHEWQGLPPETK + Deamidated (NQ)
6632 913.9153 1825.8160 1825.8258 -5.34 0 0 3.7 +1Score > 18 indicates identity DLYQEYPDEAIDVEK
205 400.6820 1598.6989 1598.7246 -16.1 1 0 2.1 +1Score > 16 indicates identity REDMLQLFSDSDK + Oxidation (M)
2747 603.2741 2409.0673 2409.0736 -2.59 0 0 4.3 +1Score > 19 indicates identity EGVPGNFYAFCSEAAHYSLYK
3040 616.7802 1231.5459 1231.5680 -18.0 0 0 2.9 +1Score > 17 indicates identity AEASIQEAEQR + Deamidated (NQ)
3488 657.2986 2625.1655 2625.1718 -2.42 0 0 4.7 +1Score > 19 indicates identity DEQEEGGTHSDIVNVVWLGDAPEK + 2 Deamidated (NQ)
1720 522.2372 1563.6899 1563.6987 -5.63 1 0 4.5 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
1744 522.2372 1563.6899 1563.6736 10.4 1 0 4.5 +1Score > 19 indicates identity MVANEEDGWRNAR + Deamidated (NQ); Oxidation (M)
2028 535.7434 2138.9445 2138.9844 -18.6 1 0 2.6 +1Score > 17 indicates identity MSVLDNWDQWKNFLGDR + Oxidation (M)
Page: Previous 1 10 11 12 13 14 15 16 17 18 19 20  76 Next 

Not what you expected? Try the select summary.