MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1301–1400 (out of 7572)

Page: Previous 1 …9 10 11 12 13 14 15 16 17 18 19 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4280 724.8293 1447.6441 1447.6474 -2.23 1 1 2.6 +1Score > 17 indicates identity NVNDRMNVTDNR + Deamidated (NQ)
4283 724.8293 2895.2883 2895.2967 -2.90 0 1 2.6 +1Score > 17 indicates identity LYEQSQNMISNLELINETSHQLNR + 6 Deamidated (NQ); Oxidation (M)
5468 819.3723 2455.0951 2455.1069 -4.80 0 1 4.3 +1Score > 20 indicates identity SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M)
5820 846.3846 2536.1319 2536.1308 0.42 1 1 3.5 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
1627 508.7311 2030.8955 2030.8898 2.77 0 1 2 +1Score > 16 indicates identity QVAEACGGGGGGRPDMAQAGGK + Deamidated (NQ)
3264 643.7925 2571.1411 2571.1257 5.97 1 1 2.7 +1Score > 18 indicates identity YKGLGEMNADQLWETTMNPESR + 2 Deamidated (NQ)
6167 873.3969 1744.7793 1744.8016 -12.8 1 1 3.8 +1Score > 19 indicates identity NNFPANEAERLEPSR + 2 Deamidated (NQ)
1161 468.2127 1868.8217 1868.8574 -19.1 1 1 3.7 +1Score > 19 indicates identity CEGIVLRTNDYGETNK + Deamidated (NQ)
1179 468.2127 1868.8217 1868.8325 -5.74 1 1 3.7 +1Score > 19 indicates identity AQKFVASYDSPSMMFK + Deamidated (NQ); 2 Oxidation (M)
1635 508.7311 2030.8955 2030.9215 -12.8 1 1 2 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
1696 508.7311 2030.8955 2030.9215 -12.8 1 1 2 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
2984 616.7802 2463.0917 2463.1258 -13.8 1 1 2.6 +1Score > 17 indicates identity SGDVTLTMFSTMTNDSEKNTLR + Oxidation (M)
4622 751.8416 3003.3374 3003.3841 -15.6 1 1 1.9 +1Score > 16 indicates identity DRQQDLFLNDEISVMTATSAFGMGIDK + 2 Deamidated (NQ)
5445 819.3723 2455.0951 2455.1359 -16.6 1 1 4.3 +1Score > 20 indicates identity MNGHDLKEMPVNGTPISEELSR + 2 Deamidated (NQ)
700 441.2004 1760.7727 1760.7563 9.30 1 1 4.1 +1Score > 19 indicates identity MNDRAYALFEEQQK + 3 Deamidated (NQ); Oxidation (M)
5441 819.3723 2455.0951 2455.0838 4.62 1 1 4.3 +1Score > 20 indicates identity RFMHHYNFPQFSVGETGPMR + 2 Deamidated (NQ); Oxidation (M)
7307 967.9399 3867.7304 3867.7230 1.92 1 1 2.3 +1Score > 17 indicates identity AIGIGDASGMFPIDESTQNYNESMVKQFDELISNK + 4 Deamidated (NQ); Oxidation (M)
576 427.6943 853.3741 853.3786 -5.31 1 1 1.8 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
1867 522.2372 2084.9199 2084.9580 -18.3 1 1 4 +1Score > 19 indicates identity QNKMMAFIESNIMPIAGR + 3 Deamidated (NQ); 2 Oxidation (M)
2029 535.7434 1069.4723 1069.4750 -2.55 1 1 2.3 +1Score > 17 indicates identity MDQFKQEK + Deamidated (NQ); Oxidation (M)
5518 819.3723 2455.0951 2455.1181 -9.38 1 1 4.3 +1Score > 20 indicates identity ETALNEVMDMLRMFGLPADDR + 2 Oxidation (M)
5620 832.8785 3327.4848 3327.5309 -13.8 1 1 2.4 +1Score > 17 indicates identity GEFMNEAVPAGEGAMAAILGMDSQALKEVTDK + 3 Oxidation (M)
658 427.6943 1706.7481 1706.7536 -3.21 0 1 1.9 +1Score > 16 indicates identity LSAGEFFPETSNHNR + 2 Deamidated (NQ)
1138 468.2127 1868.8217 1868.8462 -13.1 0 1 3.7 +1Score > 19 indicates identity TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M)
3150 630.2864 1258.5582 1258.5830 -19.7 0 1 4.1 +1Score > 19 indicates identity DQFLEQHDVK + Deamidated (NQ)
3728 670.8048 2679.1901 2679.2333 -16.1 1 1 3.2 +1Score > 18 indicates identity SNLSVEDYEGHLAVSSENIERAMK + 2 Deamidated (NQ)
1555 508.7311 2030.8955 2030.8931 1.15 0 1 2 +1Score > 16 indicates identity VATVYMTFENNPEWNAK + 2 Deamidated (NQ); Oxidation (M)
2907 616.7802 2463.0917 2463.1322 -16.4 0 1 2.6 +1Score > 17 indicates identity LVALDMDGTLLNDEQTISDENR + 2 Deamidated (NQ)
3646 670.8048 2679.1901 2679.2255 -13.2 1 1 3.2 +1Score > 18 indicates identity MIADGRLDLDELDQLSDEDIMEK + Oxidation (M)
2751 603.2741 2409.0673 2409.0426 10.3 0 1 3.9 +1Score > 19 indicates identity VETSATELNPMMFQGMYLQGK + 3 Deamidated (NQ); 2 Oxidation (M)
5324 805.8662 1609.7179 1609.7262 -5.18 1 1 3.5 +1Score > 19 indicates identity MNTQMVIRDMNPK + Deamidated (NQ); 2 Oxidation (M)
139 387.1759 1158.5058 1158.5193 -11.7 0 1 2.3 +1Score > 17 indicates identity GELPEGWDQK + Deamidated (NQ)
4255 724.8293 2895.2883 2895.3419 -18.5 1 1 2.6 +1Score > 17 indicates identity VFELRQDSWTDPDTNVIMPQMSIR + 2 Deamidated (NQ); Oxidation (M)
7230 954.4337 2860.2793 2860.3358 -19.7 1 1 3.6 +1Score > 19 indicates identity QLISTIDLSIQQAGKGEAMDQSSMFK + 3 Deamidated (NQ); 2 Oxidation (M)
158 387.1759 1544.6744 1544.7003 -16.8 0 1 2.3 +1Score > 17 indicates identity GSVPFNVMMFASDK + Oxidation (M)
767 441.2004 880.3863 880.3848 1.77 0 1 4.2 +1Score > 19 indicates identity NEMIQTK + 2 Deamidated (NQ); Oxidation (M)
1993 535.7434 2138.9445 2138.9758 -14.6 0 1 2.3 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
2102 549.2496 1096.4846 1096.4785 5.56 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology		 YTNATDADAR
3175 630.2864 1258.5582 1258.5798 -17.2 0 1 4.2 +1Score > 19 indicates identity MVHMIDVNER + Oxidation (M)
3268 643.7925 1285.5705 1285.5543 12.6 1 1 2.8 +1Score > 18 indicates identity AGQFSMGMRQR + 2 Deamidated (NQ); Oxidation (M)
4804 765.3478 3057.3620 3057.3823 -6.64 0 1 4.3 +1Score > 19 indicates identity LGGSPYNWLNNEHTGMFLMVMLASWR + 2 Deamidated (NQ); 2 Oxidation (M)
6658 913.9153 1825.8160 1825.8325 -9.02 1 1 3.3 +1Score > 18 indicates identity TQQKLQQETMALMQK + 5 Deamidated (NQ); Oxidation (M)
1009 454.7066 1814.7972 1814.7880 5.04 0 1 3.5 +1Score > 19 indicates identity TTFTDADVMDGSQSLNL + Deamidated (NQ)
1823 522.2372 2084.9199 2084.9468 -12.9 0 1 4 +1Score > 19 indicates identity EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M)
2879 603.2741 1204.5337 1204.5546 -17.4 0 1 3.9 +1Score > 19 indicates identity EMAAEHFLNK + Oxidation (M)
3484 657.2986 1968.8741 1968.9112 -18.9 0 1 4.3 +1Score > 19 indicates identity WLDQHDQVAAVGVNCTR + Deamidated (NQ)
5451 819.3723 1636.7301 1636.7250 3.11 1 1 4.4 +1Score > 20 indicates identity SSKDENPLSEEMQK + Oxidation (M)
5808 846.3846 1690.7546 1690.7758 -12.5 0 1 3.6 +1Score > 19 indicates identity DTNQETAASSQAVVDR
7046 940.9276 3759.6811 3759.6920 -2.90 1 1 2.4 +1Score > 17 indicates identity ISVGEEADENNPSIGMTWPEHPDVKMDQTLPYK + Deamidated (NQ); 2 Oxidation (M)
83 387.1759 1544.6744 1544.6824 -5.17 1 1 2.3 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
1966 535.7434 2138.9445 2138.9765 -14.9 0 1 2.4 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
234 400.6820 1598.6989 1598.6956 2.06 0 1 1.9 +1Score > 16 indicates identity NGPQGFLAADMMSVK + 2 Deamidated (NQ); 2 Oxidation (M)
242 400.6820 1598.6989 1598.6956 2.06 0 1 1.9 +1Score > 16 indicates identity NGPQGFLAADMMSVK + 2 Deamidated (NQ); 2 Oxidation (M)
3095 630.2864 2517.1164 2517.1549 -15.3 0 1 4.2 +1Score > 19 indicates identity QMAQSLEQMNVINHVMEASVEK + 2 Deamidated (NQ)
6866 927.4214 2779.2425 2779.2164 9.41 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LMENRDIDIQDANGEMEELETQGK + 2 Deamidated (NQ)
7218 954.4337 2860.2793 2860.3259 -16.3 0 1 3.6 +1Score > 19 indicates identity FVASQMAPATLDTMSVDLENNGLTFR + Deamidated (NQ); 2 Oxidation (M)
730 441.2004 1760.7727 1760.8039 -17.8 1 1 4.2 +1Score > 19 indicates identity NEQPPENSSMFKQPK + Deamidated (NQ)
2358 562.7557 2246.9936 2247.0114 -7.91 1 1 2.9 +1Score > 18 indicates identity SKDEFGQLGTSFNEMADSLR + Oxidation (M)
3606 670.8048 2679.1901 2679.2196 -11.0 1 1 3.3 +1Score > 18 indicates identity AMRGLQNEEYYMVVEIPENFSK + Deamidated (NQ); 2 Oxidation (M)
4598 751.8416 1501.6687 1501.6718 -2.10 1 1 2 +1Score > 16 indicates identity SKAYIESMSEGER + Oxidation (M)
3934 697.8171 1393.6196 1393.6222 -1.85 1 1 2.8 +1Score > 17 indicates identity ESAEEFRNQGAR + Deamidated (NQ)
253 400.6820 799.3495 799.3422 9.09 0 1 1.9 +1Score > 16 indicates identity FTMEEK + Oxidation (M)
4138 711.3232 2130.9479 2130.9481 -0.083 0 1 4.2 +1Score > 19 indicates identity LYDGESVEGYNSVDVEDLK + Deamidated (NQ)
5792 846.3846 2536.1319 2536.1362 -1.70 1 1 3.6 +1Score > 19 indicates identity FGHNEMDEPSATQPMLYDAVRK + Deamidated (NQ)
6815 927.4214 2779.2425 2779.2395 1.08 0 1 0.94 +1Score > 20 indicates identity
Score > 13 indicates homology		 FYQNLEHESSLMEIIHDNSSVDR + Deamidated (NQ); Oxidation (M)
892 454.7066 1814.7972 1814.8257 -15.7 1 1 3.5 +1Score > 19 indicates identity LLDNAFRYADQMGQR + 2 Deamidated (NQ); Oxidation (M)
1596 508.7311 1015.4477 1015.4532 -5.41 0 1 2.1 +1Score > 16 indicates identity LSEFSMVST + Oxidation (M)
2085 549.2496 1644.7269 1644.7090 10.9 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 NSDFSITACTWTNK + Deamidated (NQ)
2605 589.7679 2355.0427 2355.0246 7.68 0 1 2.6 +1Score > 17 indicates identity VDAFNQMEGIMNELNDTGLNK + 3 Deamidated (NQ)
2742 603.2741 2409.0673 2409.0828 -6.41 0 1 4 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
6507 900.4092 2698.2057 2698.2320 -9.73 1 1 3.7 +1Score > 19 indicates identity LTGSEVKDWIEMSAGQFNQIDPSK + 3 Deamidated (NQ); Oxidation (M)
6968 940.9276 3759.6811 3759.6920 -2.90 1 1 2.5 +1Score > 17 indicates identity ISVGEEADENNPSIGMTWPEHPDVKMDQTLPYK + Deamidated (NQ); 2 Oxidation (M)
7384 967.9399 1933.8652 1933.8752 -5.16 1 1 2.3 +1Score > 17 indicates identity NGQVQSNEIKNQLNSEK + 5 Deamidated (NQ)
1728 522.2372 1563.6899 1563.6987 -5.63 1 1 4.1 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
6478 900.4092 2698.2057 2698.1778 10.3 0 1 3.7 +1Score > 19 indicates identity SMFSEMEEDQNVLAYFSLLEER + 2 Oxidation (M)
951 454.7066 907.3986 907.4069 -9.16 1 1 3.6 +1Score > 19 indicates identity MTNKNDGK + Deamidated (NQ)
5371 805.8662 1609.7179 1609.7328 -9.26 0 1 3.6 +1Score > 19 indicates identity MSQIEGMDVGDVLGK + 2 Oxidation (M)
5796 846.3846 3381.5092 3381.5699 -17.9 1 1 3.6 +1Score > 19 indicates identity LWLGWMSNWQYANDVPTSPWRSAMSIPR + Deamidated (NQ); 2 Oxidation (M)
370 414.1881 1239.5426 1239.5554 -10.3 1 0 4.1 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
1321 481.7188 961.4231 961.4240 -0.88 0 0 2.6 +1Score > 17 indicates identity DELEQAEK + Deamidated (NQ)
1501 495.2250 1976.8708 1976.8608 5.07 1 0 3.9 +1Score > 19 indicates identity MTQDEFYMKEAVNEAR + Oxidation (M)
1636 508.7311 2030.8955 2030.9215 -12.8 1 0 2.1 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
1801 522.2372 2084.9199 2084.9572 -17.9 1 0 4.1 +1Score > 19 indicates identity TSAMNDRDFVNELLTTEK + 2 Deamidated (NQ)
4943 778.8539 1555.6932 1555.7010 -5.04 1 0 3.3 +1Score > 18 indicates identity FTSDESDIPMKMR
5814 846.3846 1690.7546 1690.7534 0.74 0 0 3.7 +1Score > 19 indicates identity DDTAVTDEDVQNELK
1725 522.2372 2084.9199 2084.9077 5.82 1 0 4.2 +1Score > 19 indicates identity NEQGMAHAAMAYSKQMLR + Deamidated (NQ); 3 Oxidation (M)
3710 670.8048 1339.5951 1339.5900 3.75 0 0 3.3 +1Score > 18 indicates identity SDSMMVIHYNK + Oxidation (M)
7389 967.9399 1933.8652 1933.8774 -6.33 1 0 2.4 +1Score > 17 indicates identity YEIHCKMVAEDNNGVR
2208 549.2496 1096.4846 1096.5005 -14.5 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MSCTVQKSR + Deamidated (NQ)
2812 603.2741 1204.5337 1204.5459 -10.2 0 0 4 +1Score > 19 indicates identity EAGLLDDQSEK + Deamidated (NQ)
5614 832.8785 3327.4848 3327.5309 -13.8 1 0 2.6 +1Score > 17 indicates identity GEFMNEAVPAGEGAMAAILGMDSQALKEVTDK + 3 Oxidation (M)
3434 657.2986 1968.8741 1968.8768 -1.38 1 0 4.4 +1Score > 19 indicates identity MEEDMETLQVESVNRK + 2 Oxidation (M)
4197 711.3232 2841.2639 2841.2810 -6.03 1 0 4.3 +1Score > 19 indicates identity QAGYQMAVTTEPGAASRDQGMYALHR + Deamidated (NQ); 2 Oxidation (M)
5487 819.3723 2455.0951 2455.1002 -2.06 0 0 4.5 +1Score > 20 indicates identity NVFMFLEPGESPNYPEGIQDR + Deamidated (NQ); Oxidation (M)
1507 495.2250 1976.8708 1976.9070 -18.3 0 0 3.9 +1Score > 19 indicates identity TLENEPNLTMLQGMVER + 3 Deamidated (NQ)
1898 535.7434 2138.9445 2138.9765 -14.9 0 0 2.4 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
2766 603.2741 2409.0673 2409.0828 -6.41 0 0 4 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
6295 886.9030 3543.5830 3543.6470 -18.1 1 0 2.7 +1Score > 17 indicates identity SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ)
1764 522.2372 2084.9199 2084.9468 -12.9 0 0 4.2 +1Score > 19 indicates identity EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M)
1830 522.2372 2084.9199 2084.9221 -1.09 0 0 4.2 +1Score > 19 indicates identity GVPDNQAEIIACEGNFHGR + 2 Deamidated (NQ)
Page: Previous 1 …9 10 11 12 13 14 15 16 17 18 19 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/