MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1201–1300 (out of 7572)

Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3751 684.3109 2733.2145 2733.2585 -16.1 0 1 3.8 +1Score > 19 indicates identity QIYEDQFSEIYGDDIIAPPYNLK + 3 Deamidated (NQ)
4444 738.3355 2211.9847 2212.0028 -8.16 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MDNQELTMPTKYDPSAVEK + Oxidation (M)
371 414.1881 1239.5426 1239.5230 15.8 0 1 3.6 +1Score > 19 indicates identity IYYGNYGSMR + Deamidated (NQ); Oxidation (M)
1779 522.2372 2084.9199 2084.9580 -18.3 1 1 3.7 +1Score > 19 indicates identity QNKMMAFIESNIMPIAGR + 3 Deamidated (NQ); 2 Oxidation (M)
4187 711.3232 2841.2639 2841.2684 -1.59 1 1 3.8 +1Score > 19 indicates identity EGASGNCLYNVNLVKQLPLNSMENR + 6 Deamidated (NQ); Oxidation (M)
5359 805.8662 1609.7179 1609.7471 -18.1 1 1 3.2 +1Score > 19 indicates identity AIYNNEVSQKGEEK + 2 Deamidated (NQ)
6960 940.9276 1879.8405 1879.8655 -13.3 1 1 2.2 +1Score > 17 indicates identity MENETNVKQEAMAQLK + Deamidated (NQ); Oxidation (M)
807 441.2004 1760.7727 1760.8014 -16.3 1 1 3.9 +1Score > 19 indicates identity REVYDLMTFWMDR
2154 549.2496 2192.9692 2193.0008 -14.4 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QAKLDGNTDNMSLWAGQSVR + 3 Deamidated (NQ)
3775 684.3109 1366.6073 1366.6252 -13.1 1 1 3.9 +1Score > 19 indicates identity QLFGESEGKDEK + Deamidated (NQ)
5241 792.3600 3165.4111 3165.4416 -9.65 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 RLVEQVLEMIHQDYMNDISLESCADR + 2 Deamidated (NQ)
6638 913.9153 3651.6320 3651.6379 -1.60 1 1 3.1 +1Score > 18 indicates identity QVVIDGETCLLDILDTAGQEEYSAMRDQYMR + Deamidated (NQ); 2 Oxidation (M)
639 427.6943 1706.7481 1706.7496 -0.85 0 1 1.7 +1Score > 16 indicates identity GAAGDNGIYNQDLNER + Deamidated (NQ)
3171 630.2864 2517.1164 2517.1549 -15.3 0 1 3.9 +1Score > 19 indicates identity QMAQSLEQMNVINHVMEASVEK + 2 Deamidated (NQ)
5459 819.3723 2455.0951 2455.1069 -4.80 0 1 4 +1Score > 20 indicates identity SVQALEQAMMNDHMIFLATQK + 2 Deamidated (NQ); 3 Oxidation (M)
3265 643.7925 2571.1411 2571.1509 -3.82 1 1 2.6 +1Score > 18 indicates identity KMELEDADVLCQYWSDPEVTK + Oxidation (M)
4191 711.3232 2130.9479 2130.9602 -5.75 0 1 3.9 +1Score > 19 indicates identity MGGQYIFSSVPIMNAEQNK + 2 Deamidated (NQ); Oxidation (M)
968 454.7066 907.3986 907.4069 -9.16 0 1 3.2 +1Score > 19 indicates identity DMSNLSNK
1424 495.2250 1976.8708 1976.8608 5.07 1 1 3.5 +1Score > 19 indicates identity MTQDEFYMKEAVNEAR + Oxidation (M)
6390 886.9030 1771.7915 1771.8120 -11.6 1 1 2.4 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
3004 616.7802 1231.5459 1231.5316 11.6 0 1 2.5 +1Score > 17 indicates identity QAQAQQDGGAGAK + 3 Deamidated (NQ)
2948 616.7802 2463.0917 2463.1363 -18.1 0 1 2.5 +1Score > 17 indicates identity SGYENVITVDMGGTSYDVSVIEK + Deamidated (NQ)
6169 873.3969 2617.1689 2617.1894 -7.82 1 1 3.7 +1Score > 19 indicates identity NFGNIATAMVTPFDKNENIDFQK + 4 Deamidated (NQ)
2936 616.7802 2463.0917 2463.1144 -9.21 0 1 2.5 +1Score > 17 indicates identity MANQNSSNQLLVPGAAQAIEQMK + 5 Deamidated (NQ); Oxidation (M)
4787 765.3478 2293.0215 2293.0572 -15.6 1 1 4 +1Score > 19 indicates identity YQSKEDQMYFSIIDQEIR + Deamidated (NQ)
5949 859.8907 1717.7669 1717.7981 -18.2 0 1 2 +1Score > 16 indicates identity MPSVESFELDHNAVK + Oxidation (M)
7060 940.9276 1879.8406 1879.8669 -14.0 1 1 2.3 +1Score > 17 indicates identity GGAETMIMNIYRHTDR + Oxidation (M)
7061 940.9276 1879.8406 1879.8292 6.06 0 1 2.3 +1Score > 17 indicates identity EAGDCSVGQQQMIEIAK + Deamidated (NQ); Oxidation (M)
2640 589.7679 2355.0427 2355.0227 8.47 0 1 2.4 +1Score > 17 indicates identity AENEWYMSPFQLQAAMYFK + 2 Deamidated (NQ)
2759 603.2741 2409.0673 2409.0498 7.28 1 1 3.7 +1Score > 19 indicates identity QMIDEAVDLAEKQDDPTMMGR + Deamidated (NQ); Oxidation (M)
3887 684.3109 2733.2145 2733.2592 -16.3 1 1 3.9 +1Score > 19 indicates identity NAPSLRSQMNGVQFEIYNLYVDR + 4 Deamidated (NQ); Oxidation (M)
4055 697.8171 2787.2392 2787.2923 -19.0 1 1 2.6 +1Score > 17 indicates identity RVPFASVIYAFSDQGDNQSGDLGGMR + Deamidated (NQ)
4794 765.3478 2293.0215 2293.0572 -15.6 1 1 4 +1Score > 19 indicates identity YQSKEDQMYFSIIDQEIR + Deamidated (NQ)
6882 927.4214 3705.6567 3705.7158 -16.0 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ELTQPSMFSGNHFFGGGGSFFSQPSQAQTQTAAKK + Deamidated (NQ)
59 387.1759 1158.5058 1158.4942 10.0 0 1 2.1 +1Score > 17 indicates identity FQYSSQAGDR + Deamidated (NQ)
1132 468.2127 934.4109 934.4066 4.58 0 1 3.6 +1Score > 19 indicates identity DATPEQMK + Oxidation (M)
2684 589.7679 1177.5213 1177.5285 -6.05 0 1 2.4 +1Score > 17 indicates identity LSQEALNNCK + 2 Deamidated (NQ)
1467 495.2250 1976.8708 1976.8786 -3.92 0 1 3.6 +1Score > 19 indicates identity DNMTVIWLGNNGSPQDAK + 2 Deamidated (NQ); Oxidation (M)
1842 522.2372 1563.6899 1563.7086 -12.0 1 1 3.8 +1Score > 19 indicates identity GAELEQKSQDMEAK + Deamidated (NQ)
2372 562.7557 2246.9936 2246.9857 3.50 1 1 2.7 +1Score > 18 indicates identity IGVMDYLNMKNIDADTDMR + Deamidated (NQ); 2 Oxidation (M)
2511 576.2618 1150.5091 1150.5176 -7.33 1 1 4.1 +1Score > 20 indicates identity MDQQQLKNK + 3 Deamidated (NQ); Oxidation (M)
4319 724.8293 2895.2883 2895.3322 -15.2 1 1 2.5 +1Score > 17 indicates identity VNQLSGSIQMAQMMLQMFHAMRTQD
7145 954.4337 3813.7058 3813.6621 11.4 0 1 3.4 +1Score > 19 indicates identity AMTNLASHSTSNPTSVAQYGAIAAYNGPNEPVEEMR + 4 Deamidated (NQ); 2 Oxidation (M)
362 414.1881 1652.7235 1652.7273 -2.31 0 1 3.7 +1Score > 19 indicates identity SQLMQCAQLINQAK + 5 Deamidated (NQ); Oxidation (M)
3418 657.2986 1312.5827 1312.5574 19.3 0 1 4 +1Score > 19 indicates identity MQTGMSVQEMR + Oxidation (M)
5046 778.8539 1555.6932 1555.6712 14.1 0 1 3 +1Score > 18 indicates identity GVDMDAYEVGQEVK + Deamidated (NQ); Oxidation (M)
7049 940.9276 1879.8405 1879.8655 -13.3 1 1 2.3 +1Score > 17 indicates identity MENETNVKQEAMAQLK + Deamidated (NQ); Oxidation (M)
1434 495.2250 1976.8708 1976.9010 -15.3 0 1 3.6 +1Score > 19 indicates identity GAMLTHQNLFSNANDTAR + Deamidated (NQ); Oxidation (M)
1790 522.2372 1563.6899 1563.7086 -12.0 1 1 3.8 +1Score > 19 indicates identity LEKNGEMTEDELR + Deamidated (NQ)
2659 589.7679 1177.5213 1177.5099 9.75 1 1 2.4 +1Score > 17 indicates identity GLADDDSDNKK + Deamidated (NQ)
4903 765.3478 2293.0215 2293.0572 -15.6 1 1 4 +1Score > 19 indicates identity YQSKEDQMYFSIIDQEIR + Deamidated (NQ)
5828 846.3846 1690.7546 1690.7686 -8.25 1 1 3.4 +1Score > 19 indicates identity QDVESYQKNEQPPK + 2 Deamidated (NQ)
1865 522.2372 2084.9199 2084.9468 -12.9 0 1 3.8 +1Score > 19 indicates identity EIGMIFQDPMTSLNPTMK + Deamidated (NQ); 2 Oxidation (M)
3197 630.2864 2517.1164 2517.1442 -11.0 1 1 4 +1Score > 19 indicates identity NNESNFLMYQTENGDTKIQVR + Deamidated (NQ); Oxidation (M)
4154 711.3232 1420.6319 1420.6391 -5.06 1 1 4 +1Score > 19 indicates identity DMQKAQEELAEK + 2 Deamidated (NQ)
5030 778.8539 1555.6932 1555.7188 -16.4 1 1 3 +1Score > 18 indicates identity KFQSATMNETIER + 2 Deamidated (NQ)
5795 846.3846 2536.1319 2536.1329 -0.38 1 1 3.4 +1Score > 19 indicates identity TDFIKANGLSGAMFWDFSGDSNR + Deamidated (NQ)
7613 980.1954 3916.7526 3916.7054 12.0 0 1 1.9 +1Score > 16 indicates identity AFGMSMLMMPIMTAGMNQLPQHLNSHGTAMSNTLR + 2 Deamidated (NQ); 6 Oxidation (M)
1644 508.7311 1015.4477 1015.4610 -13.1 0 1 2 +1Score > 16 indicates identity EWAQQPEK + Deamidated (NQ)
1296 481.7188 1922.8463 1922.8754 -15.1 0 1 2.4 +1Score > 17 indicates identity PEFENLVQGQMEIMDK + Oxidation (M)
1392 495.2250 988.4354 988.4219 13.7 0 1 3.6 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
2777 603.2741 1204.5337 1204.5459 -10.1 0 1 3.7 +1Score > 19 indicates identity EAQNISEADVK + 2 Deamidated (NQ)
5449 819.3723 1636.7301 1636.7515 -13.1 1 1 4.2 +1Score > 20 indicates identity GIAENDAFLKDECR
7513 980.1954 3916.7526 3916.8308 -20.0 0 1 1.9 +1Score > 16 indicates identity DMMNEANTELGFEANGPIAVEVYSLQAQGMVIIVTK + 3 Deamidated (NQ); 2 Oxidation (M)
79 387.1759 772.3372 772.3351 2.65 0 1 2.2 +1Score > 17 indicates identity DGTHSEK
486 414.1881 1652.7235 1652.7278 -2.62 1 1 3.8 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
2301 562.7557 2246.9936 2246.9579 15.9 0 1 2.7 +1Score > 18 indicates identity MEDWGIEPYFDDAGNLFGR + Oxidation (M)
2519 576.2618 1725.7637 1725.7917 -16.3 1 1 4.2 +1Score > 20 indicates identity NALSSAYANSTDAERR + Deamidated (NQ)
5631 832.8785 3327.4848 3327.5309 -13.8 1 1 2.4 +1Score > 17 indicates identity GEFMNEAVPAGEGAMAAILGMDSQALKEVTDK + 3 Oxidation (M)
5855 846.3846 1690.7546 1690.7686 -8.25 1 1 3.4 +1Score > 19 indicates identity QDVESYQKNEQPPK + 2 Deamidated (NQ)
306 400.6820 1598.6989 1598.7261 -17.0 0 1 1.8 +1Score > 16 indicates identity MHFMELFPYEQK
490 414.1881 1652.7235 1652.7529 -17.8 1 1 3.8 +1Score > 19 indicates identity DTDSALKENEDIFR + Deamidated (NQ)
2246 562.7557 2246.9936 2246.9637 13.3 1 1 2.7 +1Score > 18 indicates identity SNDEFGQLGKSFNDMAESLR + 3 Deamidated (NQ)
5676 832.8785 1663.7424 1663.7480 -3.34 1 1 2.4 +1Score > 17 indicates identity TARNMNPLMAMAADR + 2 Deamidated (NQ)
1818 522.2372 2084.9199 2084.9175 1.15 0 1 3.9 +1Score > 19 indicates identity GDDPYFTLQAVLDDQSSGR + 2 Deamidated (NQ)
3826 684.3109 2733.2145 2733.2084 2.24 1 1 4 +1Score > 19 indicates identity MQDIIYCEGANRFPGVDTEQVMK + Deamidated (NQ); 2 Oxidation (M)
238 400.6820 1598.6989 1598.6812 11.1 0 1 1.8 +1Score > 16 indicates identity MLMQVMQDPEMAK + 3 Oxidation (M)
5817 846.3846 1690.7546 1690.7508 2.24 1 1 3.4 +1Score > 19 indicates identity YNYDDLMTQLRDK + Deamidated (NQ); Oxidation (M)
6852 927.4214 3705.6567 3705.6338 6.19 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 QDTSDSNPYQEEFEIPYRPNMNVISALMEIR + 4 Deamidated (NQ); Oxidation (M)
533 427.6943 1706.7481 1706.7801 -18.7 0 1 1.8 +1Score > 16 indicates identity FHNDPDHEWILER
5948 859.8907 1717.7669 1717.7842 -10.0 1 1 2.1 +1Score > 16 indicates identity MADHHEHALNPKSSK + Deamidated (NQ); Oxidation (M)
6226 873.3969 2617.1689 2617.2193 -19.2 0 1 3.8 +1Score > 19 indicates identity LYEMFMGPLDASIAWSTTGLDGAR + Oxidation (M)
6502 900.4092 3597.6076 3597.5857 6.09 1 1 3.5 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
1257 481.7188 961.4231 961.4352 -12.6 0 1 2.4 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
5457 819.3723 1636.7301 1636.7371 -4.30 1 1 4.2 +1Score > 20 indicates identity MMMLNDVHNSLRK + Deamidated (NQ); 3 Oxidation (M)
6291 886.9030 1771.7915 1771.8120 -11.6 1 1 2.5 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
309 400.6820 1598.6989 1598.6738 15.7 0 1 1.9 +1Score > 16 indicates identity TNACMNIDMIGSVR + 2 Deamidated (NQ); Oxidation (M)
1909 535.7434 2138.9445 2138.9830 -18.0 0 1 2.3 +1Score > 17 indicates identity GSALGSDAFFPMPDTVEEAAK
2631 589.7679 2355.0427 2355.0762 -14.2 0 1 2.5 +1Score > 17 indicates identity EMQLLHNFALLYAAMDNSEK + 2 Deamidated (NQ); Oxidation (M)
5315 805.8662 3219.4357 3219.4408 -1.57 0 1 3.4 +1Score > 19 indicates identity NWDEVFTETPIQYDVNITIEEFGSQSR + 3 Deamidated (NQ)
5799 846.3846 2536.1319 2536.1308 0.42 1 1 3.5 +1Score > 19 indicates identity AKAEMTAEHNEVDTMIASLEDSK + Deamidated (NQ); Oxidation (M)
2225 562.7557 1123.4968 1123.5145 -15.8 1 1 2.8 +1Score > 18 indicates identity DEQANKQYK + Deamidated (NQ)
2413 576.2618 2301.0183 2301.0545 -15.7 0 1 4.2 +1Score > 20 indicates identity DFSDVIMAFSEDPEMLALAGK + Oxidation (M)
4260 724.8293 1447.6441 1447.6474 -2.23 1 1 2.5 +1Score > 17 indicates identity NVNDRMNVTDNR + Deamidated (NQ)
7197 954.4337 2860.2793 2860.3185 -13.7 0 1 3.5 +1Score > 19 indicates identity SQQSSDPDPNCVDRPVEGYLAVAVVR + 3 Deamidated (NQ)
4440 738.3355 2949.3129 2949.2729 13.6 1 1 0.97 +1Score > 20 indicates identity
Score > 13 indicates homology		 YRGYNPSKPNSPDNEFNWFDAVSNK + 4 Deamidated (NQ)
572 427.6943 853.3741 853.3673 7.87 1 1 1.8 +1Score > 16 indicates identity NMADMKK + Deamidated (NQ); Oxidation (M)
821 441.2004 1320.5795 1320.6058 -19.9 1 1 4.1 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
937 454.7066 907.3986 907.3883 11.3 0 1 3.4 +1Score > 19 indicates identity DTTDSVDR
1784 522.2372 1563.6899 1563.6619 17.9 1 1 4 +1Score > 19 indicates identity MDFNTIAKMMNSK + 2 Deamidated (NQ); 2 Oxidation (M)
Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/