MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1101–1200 (out of 7572)

Page: Previous 1 …7 8 9 10 11 12 13 14 15 16 17 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2122 549.2496 1644.7269 1644.7420 -9.16 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 SDLNNYKPNFFER + 2 Deamidated (NQ)
3696 670.8048 1339.5951 1339.5813 10.3 0 1 2.8 +1Score > 18 indicates identity MTELSEAEGTEK + Oxidation (M)
4450 738.3355 2949.3129 2949.3589 -15.6 1 1 0.88 +1Score > 20 indicates identity
Score > 13 indicates homology		 SLHQNFDDVQGKVEDLWLSQQMLAK + 5 Deamidated (NQ); Oxidation (M)
68 387.1759 1544.6744 1544.6995 -16.2 0 1 2 +1Score > 17 indicates identity DYTLSDNGSGFEIK
583 427.6943 1706.7481 1706.7668 -11.0 0 1 1.6 +1Score > 16 indicates identity MTEQNAIDQIEQLR + 3 Deamidated (NQ); Oxidation (M)
2116 549.2496 1096.4846 1096.5045 -18.2 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AFVVMMDPR + 2 Oxidation (M)
2749 603.2741 2409.0673 2409.0426 10.3 0 1 3.4 +1Score > 19 indicates identity VETSATELNPMMFQGMYLQGK + 3 Deamidated (NQ); 2 Oxidation (M)
3368 643.7925 1285.5705 1285.5907 -15.7 1 1 2.4 +1Score > 18 indicates identity RLTGMFANGMR + Deamidated (NQ); 2 Oxidation (M)
5123 792.3600 3165.4111 3165.3862 7.86 0 1 0.89 +1Score > 20 indicates identity
Score > 13 indicates homology		 MIEQASMTPGTIFMSSQVTAPTEEDMLR + Deamidated (NQ); 4 Oxidation (M)
7191 954.4337 3813.7058 3813.6621 11.4 0 1 3.1 +1Score > 19 indicates identity AMTNLASHSTSNPTSVAQYGAIAAYNGPNEPVEEMR + 4 Deamidated (NQ); 2 Oxidation (M)
169 387.1759 1544.6744 1544.6994 -16.2 0 1 2 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
4803 765.3478 3057.3620 3057.4021 -13.1 0 1 3.7 +1Score > 19 indicates identity MLATAIHMLQGTPYIYQGEELGMTNPK + 3 Deamidated (NQ); 3 Oxidation (M)
5049 778.8539 1555.6932 1555.7114 -11.7 1 1 2.8 +1Score > 18 indicates identity HSGENQEEQRLVK + 3 Deamidated (NQ)
410 414.1881 1652.7235 1652.7278 -2.62 1 1 3.4 +1Score > 19 indicates identity RFNTANDDNVTQVR + 4 Deamidated (NQ)
760 441.2004 880.3863 880.3960 -11.0 0 1 3.6 +1Score > 19 indicates identity DAMASGVSK + Oxidation (M)
2425 576.2618 2301.0183 2301.0623 -19.1 0 1 3.8 +1Score > 20 indicates identity SLMQHGEDFLYQYNLNSLK + 2 Deamidated (NQ)
5125 792.3600 1582.7055 1582.7086 -1.93 0 1 0.99 +1Score > 20 indicates identity
Score > 14 indicates homology		 SSTFVYTYQNMAR + Oxidation (M)
2463 576.2618 1150.5091 1150.5254 -14.2 1 1 3.8 +1Score > 20 indicates identity ALYNRGVNDE + Deamidated (NQ)
5450 819.3723 3273.4602 3273.4837 -7.19 0 1 3.8 +1Score > 20 indicates identity AGYDADLVDATLDNDEFLEETAAEVAPTYR
7540 980.1954 3916.7526 3916.7054 12.0 0 1 1.7 +1Score > 16 indicates identity AFGMSMLMMPIMTAGMNQLPQHLNSHGTAMSNTLR + 2 Deamidated (NQ); 6 Oxidation (M)
2183 549.2496 1096.4846 1096.4859 -1.16 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NALFEMAER + Deamidated (NQ); Oxidation (M)
3167 630.2864 2517.1164 2517.1516 -14.0 1 1 3.7 +1Score > 19 indicates identity SGRQGDPGITQFYLSMEDELMK + Oxidation (M)
4220 711.3232 2841.2639 2841.3088 -15.8 0 1 3.7 +1Score > 19 indicates identity HDFSAYDLILMDLNLGEINGMDLSK + 2 Deamidated (NQ); Oxidation (M)
6371 886.9030 3543.5830 3543.6470 -18.1 1 1 2.3 +1Score > 17 indicates identity SFFFDTVENDYGRDFLNVFTENAGLLLENR + 2 Deamidated (NQ)
30 387.1759 772.3372 772.3248 16.1 0 1 2 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1759 522.2372 1563.6899 1563.6987 -5.63 1 1 3.6 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
2626 589.7679 1177.5213 1177.5325 -9.47 0 1 2.3 +1Score > 17 indicates identity MNWEQEVLK + 2 Deamidated (NQ)
5026 778.8539 3111.3864 3111.4481 -19.8 1 1 2.8 +1Score > 18 indicates identity EYMITAEGQKALQSWLEEPINDIASEK + 3 Deamidated (NQ); Oxidation (M)
7033 940.9276 1879.8405 1879.8655 -13.3 1 1 2.1 +1Score > 17 indicates identity MENETNVKQEAMAQLK + Deamidated (NQ); Oxidation (M)
2169 549.2496 2192.9692 2192.9684 0.35 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EYCPNNFNERTYGTVSIK + 2 Deamidated (NQ)
4133 711.3232 2130.9479 2130.9503 -1.11 1 1 3.7 +1Score > 19 indicates identity CLGMVRQWQEIFYDER + 2 Deamidated (NQ)
4933 778.8539 3111.3864 3111.3592 8.75 0 1 2.8 +1Score > 18 indicates identity TSPIAWDMNCLEEVCGACSMVINGKPR + Deamidated (NQ); Oxidation (M)
547 427.6943 853.3741 853.3786 -5.31 1 1 1.6 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
1839 522.2372 2084.9199 2084.9221 -1.09 0 1 3.6 +1Score > 19 indicates identity GVPDNQAEIIACEGNFHGR + 2 Deamidated (NQ)
4779 765.3478 1528.6810 1528.7079 -17.6 0 1 3.8 +1Score > 19 indicates identity FNPDSSLSLMTSSK + Oxidation (M)
723 441.2004 1760.7727 1760.7714 0.71 0 1 3.7 +1Score > 19 indicates identity TNHSNITTSHTYDDR
2064 549.2496 1644.7269 1644.7090 10.9 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NSDFSITACTWTNK + Deamidated (NQ)
2332 562.7557 2246.9936 2247.0260 -14.4 1 1 2.5 +1Score > 18 indicates identity EVQDMITKNASHGMVGDLNR + Deamidated (NQ); 2 Oxidation (M)
4940 778.8539 3111.3864 3111.3592 8.75 0 1 2.8 +1Score > 18 indicates identity TSPIAWDMNCLEEVCGACSMVINGKPR + Deamidated (NQ); Oxidation (M)
29 387.1759 772.3372 772.3248 16.1 0 1 2 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
39 387.1759 772.3372 772.3248 16.1 0 1 2 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1324 481.7188 961.4231 961.4352 -12.6 1 1 2.2 +1Score > 17 indicates identity DAGDQKAEK + Deamidated (NQ)
1547 508.7311 1015.4477 1015.4610 -13.1 0 1 1.8 +1Score > 16 indicates identity QPYPPEER + Deamidated (NQ)
2905 616.7802 1231.5459 1231.5680 -18.0 0 1 2.4 +1Score > 17 indicates identity AEASIQEAEQR + Deamidated (NQ)
3256 643.7925 2571.1411 2571.1767 -13.9 1 1 2.5 +1Score > 18 indicates identity SMGPDGLKEVTENAVLNANYMMR + 2 Oxidation (M)
3764 684.3109 1366.6073 1366.6252 -13.1 1 1 3.7 +1Score > 19 indicates identity QLFGESEGKDEK + Deamidated (NQ)
4686 751.8416 3003.3374 3003.3531 -5.25 1 1 1.7 +1Score > 16 indicates identity QFDFDDMASACWQLFQEQPDILKR + Oxidation (M)
6959 940.9276 3759.6811 3759.6776 0.93 1 1 2.2 +1Score > 17 indicates identity EADSPKTPAMPLETCVSMTQGMIGYWLQNALDR + 2 Deamidated (NQ); 3 Oxidation (M)
550 427.6943 1706.7481 1706.7536 -3.21 0 1 1.7 +1Score > 16 indicates identity LSAGEFFPETSNHNR + 2 Deamidated (NQ)
1576 508.7311 2030.8955 2030.9111 -7.73 0 1 1.8 +1Score > 16 indicates identity ISSGSFQTDGMIVAPCSMK + Oxidation (M)
1960 535.7434 2138.9445 2138.9758 -14.6 0 1 2.1 +1Score > 17 indicates identity NAMGAANAMVAADMALAGITSR + Deamidated (NQ); 2 Oxidation (M)
6484 900.4092 2698.2057 2698.2288 -8.55 0 1 3.2 +1Score > 19 indicates identity IMQDTMDLLHAQANLDNVQMHLK + 4 Deamidated (NQ); Oxidation (M)
1044 468.2127 1401.6163 1401.5983 12.9 0 1 3.4 +1Score > 19 indicates identity AQSYNMQDAAFR + Deamidated (NQ)
1153 468.2127 1868.8217 1868.8574 -19.1 1 1 3.4 +1Score > 19 indicates identity CEGIVLRTNDYGETNK + Deamidated (NQ)
1175 468.2127 934.4109 934.4290 -19.4 1 1 3.4 +1Score > 19 indicates identity AEGSERMR
6284 886.9030 1771.7915 1771.7770 8.16 0 1 2.3 +1Score > 17 indicates identity SGMGYASINHPVDHCK
709 441.2004 1760.7727 1760.8039 -17.8 1 1 3.7 +1Score > 19 indicates identity NEQPPENSSMFKQPK + Deamidated (NQ)
977 454.7066 1814.7972 1814.8282 -17.1 1 1 3.1 +1Score > 19 indicates identity IQNGDSQGEQPAKQDAK + 2 Deamidated (NQ)
4782 765.3478 3057.3620 3057.4021 -13.1 0 1 3.8 +1Score > 19 indicates identity MLATAIHMLQGTPYIYQGEELGMTNPK + 3 Deamidated (NQ); 3 Oxidation (M)
1681 508.7311 2030.8955 2030.9215 -12.8 1 1 1.8 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
3535 657.2986 1312.5827 1312.6081 -19.4 0 1 3.8 +1Score > 19 indicates identity TANLSDYMLGGR + Oxidation (M)
3994 697.8171 2787.2392 2787.2163 8.22 1 1 2.5 +1Score > 17 indicates identity HIDYNGRLCMSAAATAANQTFGMDR + Deamidated (NQ); Oxidation (M)
1746 522.2372 1563.6899 1563.6987 -5.63 1 1 3.6 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
4109 711.3232 2130.9479 2130.9788 -14.5 0 1 3.8 +1Score > 19 indicates identity MQDMGAVTIPNLLFMNYR + 2 Deamidated (NQ); Oxidation (M)
4823 765.3478 2293.0215 2293.0184 1.37 0 1 3.8 +1Score > 19 indicates identity SMMYEGLQHYFIVNFPQR + 2 Deamidated (NQ); 2 Oxidation (M)
6493 900.4092 3597.6076 3597.5857 6.09 1 1 3.2 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
7438 967.9399 3867.7304 3867.7603 -7.71 1 1 2.1 +1Score > 17 indicates identity GISEEEATEMIVMGFIEPFTKELPMEYAVEMNR + 3 Oxidation (M)
2503 576.2618 1150.5091 1150.5189 -8.50 1 1 3.9 +1Score > 20 indicates identity MNNRNNPFK + Deamidated (NQ); Oxidation (M)
3104 630.2864 1887.8373 1887.8639 -14.1 0 1 3.8 +1Score > 19 indicates identity QFQEVEAVTFQYNQR + 2 Deamidated (NQ)
3918 697.8171 1393.6196 1393.5957 17.2 0 1 2.5 +1Score > 17 indicates identity SQNSADANISSDGK + Deamidated (NQ)
4252 724.8293 1447.6441 1447.6215 15.6 0 1 2.4 +1Score > 17 indicates identity QWSAEDEEAVQR + Deamidated (NQ)
5704 832.8785 1663.7424 1663.7624 -12.0 1 1 2.2 +1Score > 17 indicates identity NRMNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
1584 508.7311 2030.8955 2030.9215 -12.8 1 1 1.8 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
1691 508.7311 2030.8955 2030.9288 -16.4 1 1 1.8 +1Score > 16 indicates identity NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M)
4606 751.8416 3003.3374 3003.3841 -15.6 1 1 1.8 +1Score > 16 indicates identity DRQQDLFLNDEISVMTATSAFGMGIDK + 2 Deamidated (NQ)
5453 819.3723 2455.0951 2455.1002 -2.06 0 1 3.9 +1Score > 20 indicates identity NVFMFLEPGESPNYPEGIQDR + Deamidated (NQ); Oxidation (M)
1809 522.2372 1042.4599 1042.4542 5.51 0 1 3.7 +1Score > 19 indicates identity MNTYNPFR + Deamidated (NQ)
4806 765.3478 3057.3620 3057.3726 -3.48 1 1 3.9 +1Score > 19 indicates identity ENINQDVYANDFDLNALQNEAEKYPK + 3 Deamidated (NQ)
95 387.1759 1544.6744 1544.6673 4.60 0 1 2.1 +1Score > 17 indicates identity EQMMYDMEALLR + Oxidation (M)
4093 711.3232 1420.6319 1420.6470 -10.6 0 1 3.8 +1Score > 19 indicates identity NLYDEVNGDPSAK
5488 819.3723 2455.0951 2455.1359 -16.6 1 1 3.9 +1Score > 20 indicates identity DLNMDCIVAEIKAQYDDIASR + Oxidation (M)
85 387.1759 1544.6744 1544.6994 -16.2 0 1 2.1 +1Score > 17 indicates identity DGSLYAGYTNNIEK + Deamidated (NQ)
745 441.2004 880.3863 880.3848 1.77 0 1 3.8 +1Score > 19 indicates identity TEMNIQK + 2 Deamidated (NQ); Oxidation (M)
1329 481.7188 1922.8463 1922.8779 -16.4 1 1 2.3 +1Score > 17 indicates identity SDNIGEEIMGKQADSIAK + 2 Deamidated (NQ); Oxidation (M)
2995 616.7802 1231.5459 1231.5680 -18.0 0 1 2.4 +1Score > 17 indicates identity GDAENGESVNIK
1603 508.7311 2030.8955 2030.9288 -16.4 1 1 1.9 +1Score > 16 indicates identity NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M)
1768 522.2372 2084.9199 2084.9071 6.14 1 1 3.7 +1Score > 19 indicates identity MVSEGSMYPVQYYDEKK + 2 Oxidation (M)
2359 562.7557 1123.4968 1123.5002 -3.00 0 1 2.6 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
3120 630.2864 2517.1164 2517.1484 -12.7 1 1 3.8 +1Score > 19 indicates identity YFEDFLKFVEYGESMPEIMK + Oxidation (M)
3609 670.8048 2679.1901 2679.1945 -1.61 1 1 3 +1Score > 18 indicates identity DDFYNEYGIRIQGNLSPLNMMR + 2 Deamidated (NQ); 2 Oxidation (M)
4215 711.3232 2130.9479 2130.9640 -7.56 0 1 3.8 +1Score > 19 indicates identity RPQNTFATMDHNIPTVNR + 4 Deamidated (NQ); Oxidation (M)
4845 765.3478 1528.6810 1528.7059 -16.3 0 1 3.9 +1Score > 19 indicates identity NPEFDPSRPQWR + Deamidated (NQ)
2014 535.7434 2138.9445 2138.9217 10.7 0 1 2.1 +1Score > 17 indicates identity TCCSSLAMAAPEVTNPVCR + Oxidation (M)
2119 549.2496 1644.7269 1644.7561 -17.8 0 1 0.83 +1Score > 20 indicates identity
Score > 13 indicates homology		 MNETLQQYMMLVK + Deamidated (NQ); Oxidation (M)
2429 576.2618 1150.5091 1150.5077 1.25 0 1 4 +1Score > 20 indicates identity NMGDPLFANR + Deamidated (NQ); Oxidation (M)
3243 643.7925 2571.1411 2571.1509 -3.82 1 1 2.5 +1Score > 18 indicates identity KMELEDADVLCQYWSDPEVTK + Oxidation (M)
5269 805.8662 1609.7179 1609.7327 -9.22 1 1 3.2 +1Score > 19 indicates identity SSKAMQALQPEMQK + 2 Deamidated (NQ); 2 Oxidation (M)
2210 549.2496 2192.9692 2192.9432 11.8 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 SENAYNSMYKTLANHNYR + 2 Deamidated (NQ); Oxidation (M)
2550 576.2618 1150.5091 1150.5189 -8.50 1 1 4 +1Score > 20 indicates identity MNNRNNPFK + Deamidated (NQ); Oxidation (M)
6818 927.4214 3705.6567 3705.6378 5.08 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 TFNEDETMLSQSINMLAQNLQDMTRAQEMQR + Deamidated (NQ); 2 Oxidation (M)
Page: Previous 1 …7 8 9 10 11 12 13 14 15 16 17 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/