MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1001–1100 (out of 7572)

Page: Previous 1 …6 7 8 9 10 11 12 13 14 15 16 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
6402 886.9030 1771.7915 1771.8233 -18.0 0 2 2.1 +1Score > 17 indicates identity VNHQVMPDVSLVDMR + Deamidated (NQ); 2 Oxidation (M)
2865 603.2741 1204.5337 1204.5207 10.7 0 2 3.1 +1Score > 19 indicates identity NDSAINNDIAR + 3 Deamidated (NQ)
4116 711.3232 2841.2639 2841.2659 -0.72 0 2 3.3 +1Score > 19 indicates identity AVAEANNMTYDINLWMDEAPSLMDK
1523 495.2250 1976.8708 1976.8716 -0.38 0 2 3 +1Score > 19 indicates identity IMMEINPTIAYTMMDR + 3 Oxidation (M)
2263 562.7557 2246.9936 2247.0100 -7.28 0 2 2.3 +1Score > 18 indicates identity IGNLQAEDEVIEMNQVEANK + 4 Deamidated (NQ)
6150 873.3969 3489.5585 3489.6021 -12.5 1 2 3.1 +1Score > 19 indicates identity LKTGDETEINGQGPVISEEDFAAFLDQFSAMK + 3 Deamidated (NQ)
6519 900.4092 3597.6076 3597.6578 -13.9 1 2 2.9 +1Score > 19 indicates identity TAKAIEQADQSAMEQEAMCFWIFHVIQQIR + 3 Deamidated (NQ); Oxidation (M)
6867 927.4214 2779.2425 2779.2607 -6.53 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VTVSASTYMNGDTSGVIRNNDEYIR + 2 Deamidated (NQ); Oxidation (M)
1131 468.2127 934.4109 934.4178 -7.42 0 2 3 +1Score > 19 indicates identity EEQLNMR + Oxidation (M)
1752 522.2372 1563.6899 1563.6736 10.4 1 2 3.3 +1Score > 19 indicates identity MVANEEDGWRNAR + Deamidated (NQ); Oxidation (M)
3416 657.2986 2625.1655 2625.1918 -10.0 1 2 3.4 +1Score > 19 indicates identity VQSCNAIRGVYGFQTYDEQSFR + Deamidated (NQ)
6523 900.4092 3597.6076 3597.6733 -18.3 0 2 2.9 +1Score > 19 indicates identity LETQLESIQQAAADFNELTPPDAAAEVHNTIEK + 5 Deamidated (NQ)
1663 508.7311 2030.8955 2030.8570 18.9 1 2 1.6 +1Score > 16 indicates identity IVMSPMCMYSSHEKDGK + 2 Oxidation (M)
2743 603.2741 1204.5337 1204.5459 -10.2 0 2 3.2 +1Score > 19 indicates identity EAGLLDDQSEK + Deamidated (NQ)
2793 603.2741 2409.0673 2409.0828 -6.41 0 2 3.2 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
3553 657.2986 1968.8741 1968.9112 -18.9 0 2 3.4 +1Score > 19 indicates identity WLDQHDQVAAVGVNCTR + Deamidated (NQ)
2474 576.2618 1725.7637 1725.7879 -14.0 1 2 3.5 +1Score > 20 indicates identity QALDRQEAMIYQNK + 3 Deamidated (NQ); Oxidation (M)
3636 670.8048 2679.1901 2679.2196 -11.0 1 2 2.6 +1Score > 18 indicates identity AMRGLQNEEYYMVVEIPENFSK + Deamidated (NQ); 2 Oxidation (M)
6119 873.3969 2617.1689 2617.1608 3.08 1 2 3.2 +1Score > 19 indicates identity SFAIEDYEQKQFDHENGNFLGK + 2 Deamidated (NQ)
6151 873.3969 1744.7793 1744.7614 10.3 0 2 3.2 +1Score > 19 indicates identity NDFLYTDNRPETMK + 2 Deamidated (NQ)
6293 886.9030 3543.5830 3543.5758 2.02 1 2 2.1 +1Score > 17 indicates identity NCMETAFYSAGQRYNVMVFNLSQGYHNGLR + Deamidated (NQ); Oxidation (M)
1750 522.2372 2084.9199 2084.8932 12.8 1 2 3.3 +1Score > 19 indicates identity LNGNTDMEWMFGKHASSK + Deamidated (NQ); 2 Oxidation (M)
3030 616.7802 1231.5459 1231.5582 -9.97 0 2 2.2 +1Score > 17 indicates identity WAAAQTEGGQGR + Deamidated (NQ)
4780 765.3478 2293.0215 2292.9957 11.3 1 2 3.5 +1Score > 19 indicates identity DMFQYSRENANQYLLNER + 3 Deamidated (NQ)
5475 819.3723 1636.7301 1636.7371 -4.30 1 2 3.5 +1Score > 20 indicates identity MMMLNDVHNSLRK + Deamidated (NQ); 3 Oxidation (M)
6710 913.9153 1825.8160 1825.8516 -19.5 1 2 2.7 +1Score > 18 indicates identity MVDQYVRNLNSDLNK + 2 Deamidated (NQ); Oxidation (M)
1795 522.2372 1563.6899 1563.6736 10.4 1 2 3.3 +1Score > 19 indicates identity MVANEEDGWRNAR + Deamidated (NQ); Oxidation (M)
2437 576.2618 1150.5091 1150.5288 -17.1 1 2 3.5 +1Score > 20 indicates identity GDTKMLEGER + Oxidation (M)
2652 589.7679 1177.5213 1177.5099 9.75 1 2 2.1 +1Score > 17 indicates identity GLADDDSDNKK + Deamidated (NQ)
6480 900.4092 3597.6076 3597.5857 6.09 1 2 2.9 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
50 387.1759 772.3372 772.3248 16.1 0 1 1.8 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
916 454.7066 1814.7972 1814.8257 -15.7 1 1 2.8 +1Score > 19 indicates identity LLDNAFRYADQMGQR + 2 Deamidated (NQ); Oxidation (M)
1357 481.7188 961.4231 961.4175 5.88 0 1 2.1 +1Score > 17 indicates identity EGEAVCLNA
4474 738.3355 2211.9847 2211.9412 19.7 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LDQMINQLQDMWEGESSR + Deamidated (NQ); 2 Oxidation (M)
5466 819.3723 1636.7301 1636.7580 -17.1 1 1 3.5 +1Score > 20 indicates identity KDIPNSYNDEVSEK
5481 819.3723 2455.0951 2455.1359 -16.6 1 1 3.6 +1Score > 20 indicates identity DLNMDCIVAEIKAQYDDIASR + Oxidation (M)
6144 873.3969 2617.1689 2617.2193 -19.2 0 1 3.2 +1Score > 19 indicates identity LYEMFMGPLDASIAWSTTGLDGAR + Oxidation (M)
1448 495.2250 1976.8708 1976.8707 0.067 1 1 3.1 +1Score > 19 indicates identity AESGYTQEKMANVLGMSK + 2 Deamidated (NQ); 2 Oxidation (M)
6292 886.9030 1771.7915 1771.8120 -11.6 1 1 2.1 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
48 387.1759 1158.5058 1158.5193 -11.6 0 1 1.9 +1Score > 17 indicates identity NSTAFAADYAK + Deamidated (NQ)
714 441.2004 1320.5795 1320.6058 -19.9 1 1 3.4 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
739 441.2004 880.3863 880.3848 1.77 0 1 3.4 +1Score > 19 indicates identity TEMNIQK + 2 Deamidated (NQ); Oxidation (M)
1782 522.2372 1563.6899 1563.7198 -19.1 1 1 3.3 +1Score > 19 indicates identity ASERLNEAMNNGLK + 2 Deamidated (NQ); Oxidation (M)
1935 535.7434 2138.9445 2138.9830 -18.0 0 1 1.9 +1Score > 17 indicates identity GSALGSDAFFPMPDTVEEAAK
2836 603.2741 2409.0673 2409.0478 8.12 0 1 3.2 +1Score > 19 indicates identity TEHHHMAVQEVNDMIQFADR + 2 Deamidated (NQ)
6485 900.4092 3597.6076 3597.6578 -13.9 1 1 3 +1Score > 19 indicates identity TAKAIEQADQSAMEQEAMCFWIFHVIQQIR + 3 Deamidated (NQ); Oxidation (M)
5662 832.8785 1663.7424 1663.7294 7.83 0 1 2.1 +1Score > 17 indicates identity GEMIDMINNGNGQVR + Deamidated (NQ); Oxidation (M)
433 414.1881 826.3617 826.3466 18.4 0 1 3.3 +1Score > 19 indicates identity MNMFER
939 454.7066 907.3986 907.4069 -9.16 0 1 2.9 +1Score > 19 indicates identity DMSNLSNK
3162 630.2864 1258.5582 1258.5717 -10.7 0 1 3.5 +1Score > 19 indicates identity ENQWVDEPIK + 2 Deamidated (NQ)
2573 589.7679 2355.0427 2355.0731 -12.9 1 1 2.1 +1Score > 17 indicates identity GMMAKIGMAMGSIVSTFYQAGR + Deamidated (NQ); 3 Oxidation (M)
3449 657.2986 2625.1655 2625.2156 -19.1 1 1 3.5 +1Score > 19 indicates identity MDQSAGLSAKEVVNEWPYEDLVK + 2 Deamidated (NQ); Oxidation (M)
5277 805.8662 1609.7179 1609.7327 -9.22 1 1 2.9 +1Score > 19 indicates identity SSKAMQALQPEMQK + 2 Deamidated (NQ); 2 Oxidation (M)
2595 589.7679 1177.5213 1177.5211 0.22 0 1 2.1 +1Score > 17 indicates identity GTSQINASQNR + 3 Deamidated (NQ)
5780 846.3846 2536.1319 2536.1619 -11.8 0 1 3 +1Score > 19 indicates identity DPHTQNYYTGFAHGTSGIAAALSR + 2 Deamidated (NQ)
6160 873.3969 2617.1689 2617.1467 8.49 0 1 3.3 +1Score > 19 indicates identity VNQLSGSIQMAQMMLQMFHAMR + 2 Deamidated (NQ); 4 Oxidation (M)
6827 927.4214 1852.8283 1852.8625 -18.4 1 1 0.93 +1Score > 20 indicates identity
Score > 14 indicates homology		 MQQQQFDQLTTAEKR + 2 Deamidated (NQ)
7160 954.4337 3813.7058 3813.7569 -13.4 1 1 3 +1Score > 19 indicates identity TDESVAIFSLEMGAEQLVMRMLCAEGNINAQNLR + 4 Deamidated (NQ)
785 441.2004 880.3863 880.4034 -19.4 0 1 3.5 +1Score > 19 indicates identity EVLDMMK + Oxidation (M)
1522 495.2250 1976.8708 1976.9070 -18.3 0 1 3.2 +1Score > 19 indicates identity TLENEPNLTMLQGMVER + 3 Deamidated (NQ)
1780 522.2372 2084.9199 2084.9361 -7.77 0 1 3.4 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
1800 522.2372 2084.9199 2084.9395 -9.40 0 1 3.4 +1Score > 19 indicates identity CETVTASMDSVDFLEPIR + Oxidation (M)
2110 549.2496 1644.7269 1644.7487 -13.3 0 1 0.79 +1Score > 20 indicates identity
Score > 13 indicates homology		 MSATVAGMAINFTGNK + Deamidated (NQ); 2 Oxidation (M)
5623 832.8785 1663.7424 1663.7624 -12.0 1 1 2.1 +1Score > 17 indicates identity NRMNGGWETIVNQK + 2 Deamidated (NQ); Oxidation (M)
6139 873.3969 2617.1689 2617.1425 10.1 1 1 3.3 +1Score > 19 indicates identity DCGSDQFPDLSGRECYVGIDLSK
6483 900.4092 3597.6076 3597.5857 6.09 1 1 3 +1Score > 19 indicates identity HPGMGMQPPQAQQRGLQQMFQPMGAAQQQAGAR + 5 Deamidated (NQ); 2 Oxidation (M)
988 454.7066 907.3986 907.3957 3.22 0 1 2.9 +1Score > 19 indicates identity QIQDEMK + Deamidated (NQ); Oxidation (M)
649 427.6943 1706.7481 1706.7649 -9.84 0 1 1.6 +1Score > 16 indicates identity GSLGGGFSSGGFSGGSFSR
1814 522.2372 1563.6899 1563.7086 -12.0 1 1 3.4 +1Score > 19 indicates identity GAELEQKSQDMEAK + Deamidated (NQ)
1614 508.7311 2030.8955 2030.9288 -16.4 1 1 1.7 +1Score > 16 indicates identity NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M)
5200 792.3600 3165.4111 3165.4338 -7.18 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EMMQTAMQNTMLINGIAQVTFDSETAVK + 4 Oxidation (M)
1046 468.2127 1868.8217 1868.8462 -13.1 0 1 3.2 +1Score > 19 indicates identity TEMLTNNIANANTPGYK + 2 Deamidated (NQ); Oxidation (M)
1626 508.7311 2030.8955 2030.8747 10.2 1 1 1.7 +1Score > 16 indicates identity NMAINPSKENLCSTFCK + 2 Deamidated (NQ); Oxidation (M)
2765 603.2741 2409.0673 2409.0828 -6.41 0 1 3.3 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
1591 508.7311 2030.8955 2030.9215 -12.8 1 1 1.7 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
1778 522.2372 1563.6899 1563.6657 15.5 0 1 3.4 +1Score > 19 indicates identity DEIINQLCQNCR + 2 Deamidated (NQ)
7398 967.9399 3867.7304 3867.7230 1.92 1 1 1.9 +1Score > 17 indicates identity AIGIGDASGMFPIDESTQNYNESMVKQFDELISNK + 4 Deamidated (NQ); Oxidation (M)
249 400.6820 1598.6989 1598.7114 -7.78 1 1 1.6 +1Score > 16 indicates identity SWDWYNTGKGATGR + Deamidated (NQ)
594 427.6943 853.3741 853.3786 -5.31 1 1 1.6 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
1383 495.2250 988.4354 988.4219 13.7 0 1 3.2 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
1617 508.7311 2030.8955 2030.9215 -12.8 1 1 1.7 +1Score > 16 indicates identity MTEDVTDNDIHEQKLSR + Deamidated (NQ)
6039 859.8907 3435.5339 3435.5922 -17.0 1 1 1.8 +1Score > 16 indicates identity QEEELKSLAAEHGMNVVSVISEQASGYEMDR
3215 630.2864 1258.5582 1258.5726 -11.5 1 1 3.5 +1Score > 19 indicates identity FTKGMNMPGLF + Deamidated (NQ); Oxidation (M)
7162 954.4337 2860.2793 2860.3186 -13.7 0 1 3 +1Score > 19 indicates identity NVVEPLPIYACNAESQGFIGYMLEK + 3 Deamidated (NQ); Oxidation (M)
5213 792.3600 3165.4111 3165.4342 -7.32 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MAEQQGNEKPFTAMGAGAQDQETAQIIER + Deamidated (NQ); Oxidation (M)
6814 927.4214 2779.2425 2779.2675 -9.00 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MDIAVLSMAMSQAALYQNVQMSLTK + 4 Deamidated (NQ); 2 Oxidation (M)
375 414.1881 1239.5426 1239.5230 15.8 0 1 3.4 +1Score > 19 indicates identity IYYGNYGSMR + Deamidated (NQ); Oxidation (M)
2112 549.2496 1096.4846 1096.4785 5.56 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 YTNATDADAR
4251 724.8293 2895.2883 2895.3419 -18.5 1 1 2.2 +1Score > 17 indicates identity VFELRQDSWTDPDTNVIMPQMSIR + 2 Deamidated (NQ); Oxidation (M)
6712 913.9153 3651.6320 3651.5909 11.3 0 1 2.9 +1Score > 18 indicates identity WQSLIEQEGPESILPYSFYGNMGNLTAEGMDR + 4 Deamidated (NQ); Oxidation (M)
22 387.1759 772.3372 772.3248 16.1 0 1 1.9 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
1799 522.2372 1563.6899 1563.6619 17.9 1 1 3.5 +1Score > 19 indicates identity MDFNTIAKMMNSK + 2 Deamidated (NQ); 2 Oxidation (M)
7148 954.4337 3813.7058 3813.7580 -13.7 1 1 3 +1Score > 19 indicates identity GAFLAGGSVNNPETSSYHLEIFSLYKEHNDSLCR + 2 Deamidated (NQ)
5289 805.8662 3219.4357 3219.4951 -18.4 1 1 3 +1Score > 19 indicates identity QQDLFLNDEISVMTATSAFGMGIDKSNIR + 3 Deamidated (NQ); Oxidation (M)
668 427.6943 1706.7481 1706.7536 -3.21 0 1 1.6 +1Score > 16 indicates identity LSAGEFFPETSNHNR + 2 Deamidated (NQ)
164 387.1759 1544.6744 1544.6995 -16.2 0 1 1.9 +1Score > 17 indicates identity DYTLSDNGSGFEIK
4695 751.8416 3003.3374 3003.3841 -15.6 1 1 1.7 +1Score > 16 indicates identity DRQQDLFLNDEISVMTATSAFGMGIDK + 2 Deamidated (NQ)
890 454.7066 1814.7972 1814.8257 -15.7 1 1 3 +1Score > 19 indicates identity LLDNAFRYADQMGQR + 2 Deamidated (NQ); Oxidation (M)
6407 886.9030 1771.7915 1771.8120 -11.6 1 1 2.2 +1Score > 17 indicates identity NNFNNMKNVVTTVMK + 3 Deamidated (NQ); Oxidation (M)
494 414.1881 1652.7235 1652.7529 -17.8 0 1 3.4 +1Score > 19 indicates identity EGFNSLSQSEQQVAK + 2 Deamidated (NQ)
Page: Previous 1 …6 7 8 9 10 11 12 13 14 15 16 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/