MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : test
MS data file : PRT1346_ENIGMA_14.mgf
Database : B-licheniformis 20211213 (4,284 sequences; 1,240,737 residues)
Timestamp : 4 Dec 2025 at 15:32:34 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 7,621

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 18 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 901–1000 (out of 7572)

Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 76 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3617 670.8048 2679.1901 2679.1866 1.31 1 2 2.4 +1Score > 18 indicates identity DRVETSATELNPMMFQGMYLQGK + 2 Deamidated (NQ); 2 Oxidation (M)
3340 643.7925 2571.1411 2571.1622 -8.20 0 2 2.1 +1Score > 18 indicates identity DGDIVGVSWGTTMYQIAQNMQPK + Deamidated (NQ); 2 Oxidation (M)
3669 670.8048 1339.5951 1339.6143 -14.4 0 2 2.4 +1Score > 18 indicates identity TAIDQTFETGEK + Deamidated (NQ)
1336 481.7188 961.4231 961.4352 -12.6 0 2 1.9 +1Score > 17 indicates identity AQSEAEAAGK + Deamidated (NQ)
2237 562.7557 1123.4968 1123.5002 -3.00 0 2 2.1 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
2253 562.7557 1123.4968 1123.5002 -3.00 0 2 2.1 +1Score > 18 indicates identity GNMAVAMATGGK + Deamidated (NQ); Oxidation (M)
5358 805.8662 3219.4357 3219.4304 1.65 0 2 2.6 +1Score > 19 indicates identity DIMSTQMVTGRPDMSAEEAGDLMAEHQIR + Deamidated (NQ)
1729 522.2372 1042.4599 1042.4719 -11.5 0 2 3 +1Score > 19 indicates identity SYTAPYNAR + Deamidated (NQ)
1773 522.2372 2084.9199 2084.9183 0.76 1 2 3 +1Score > 19 indicates identity NTYFSNKNEMIFMISGR + 2 Deamidated (NQ); 2 Oxidation (M)
2089 549.2496 1644.7269 1644.7090 10.9 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GASGYAPENTMAAFDK + Oxidation (M)
4967 778.8539 1555.6932 1555.7010 -5.04 1 2 2.4 +1Score > 18 indicates identity FTSDESDIPMKMR
896 454.7066 1814.7972 1814.8033 -3.34 0 2 2.6 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
1853 522.2372 1042.4599 1042.4607 -0.74 0 2 3 +1Score > 19 indicates identity NDQYNFIK + 2 Deamidated (NQ)
7271 954.4337 1906.8529 1906.8255 14.4 0 2 2.7 +1Score > 19 indicates identity FYDMDELTGSLETQSR + Oxidation (M)
5370 805.8662 1609.7179 1609.7262 -5.18 1 2 2.6 +1Score > 19 indicates identity MNTQMVIRDMNPK + Deamidated (NQ); 2 Oxidation (M)
1234 481.7188 961.4231 961.4240 -0.88 0 2 1.9 +1Score > 17 indicates identity DELEQAEK + Deamidated (NQ)
2280 562.7557 2246.9936 2247.0291 -15.8 1 2 2.1 +1Score > 18 indicates identity SIERNEWEDNTPETEGLTK
5224 792.3600 3165.4111 3165.4342 -7.32 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MAEQQGNEKPFTAMGAGAQDQETAQIIER + Deamidated (NQ); Oxidation (M)
159 387.1759 772.3372 772.3351 2.65 0 2 1.7 +1Score > 17 indicates identity DGTHSEK
1170 468.2127 1868.8217 1868.8540 -17.3 0 2 2.8 +1Score > 19 indicates identity GYGEFKPIASNDTEEGR
2133 549.2496 2192.9692 2192.9983 -13.3 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EVKMIHDENMEVHTFFR + 2 Oxidation (M)
5618 832.8785 3327.4848 3327.4700 4.46 1 2 1.9 +1Score > 17 indicates identity LGGGTFAQPIKLDYCHNCGDGINTPEAYEK + 3 Deamidated (NQ)
599 427.6943 1706.7481 1706.7675 -11.4 0 2 1.4 +1Score > 16 indicates identity DGQYSLSYVDFINGK + 2 Deamidated (NQ)
1829 522.2372 1563.6899 1563.7086 -12.0 1 2 3 +1Score > 19 indicates identity LEKNGEMTEDELR + Deamidated (NQ)
1864 522.2372 2084.9199 2084.9361 -7.77 0 2 3 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
2779 603.2741 2409.0673 2409.0828 -6.41 0 2 2.9 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
3798 684.3109 1366.6073 1366.6252 -13.1 1 2 3.1 +1Score > 19 indicates identity QLFGESEGKDEK + Deamidated (NQ)
998 454.7066 907.3986 907.3957 3.23 0 2 2.6 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
1017 454.7066 1814.7972 1814.8033 -3.34 0 2 2.6 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
1183 468.2127 1868.8217 1868.7855 19.4 0 2 2.9 +1Score > 19 indicates identity ASQLNGCAFCLNMHTK + 2 Deamidated (NQ); Oxidation (M)
2482 576.2618 1725.7637 1725.7814 -10.3 1 2 3.3 +1Score > 20 indicates identity EGMNIVEAMERFGSR + Deamidated (NQ)
1665 508.7311 2030.8955 2030.8626 16.2 0 2 1.5 +1Score > 16 indicates identity ASELETAFQTASSNANQMK + 4 Deamidated (NQ)
1859 522.2372 2084.9199 2084.9077 5.82 1 2 3.1 +1Score > 19 indicates identity NEQGMAHAAMAYSKQMLR + Deamidated (NQ); 3 Oxidation (M)
2026 535.7434 2138.9445 2138.9765 -14.9 0 2 1.8 +1Score > 17 indicates identity QFAAGQLAMMINGSWNIER + 3 Deamidated (NQ)
5255 792.3600 2374.0583 2374.0821 -10.0 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QGDPGITQFYLSMEDELMKR + Deamidated (NQ); Oxidation (M)
37 387.1759 772.3372 772.3248 16.1 0 2 1.7 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
215 400.6820 799.3495 799.3646 -19.0 0 2 1.5 +1Score > 16 indicates identity MEHINR + Deamidated (NQ)
1836 522.2372 2084.9199 2084.9361 -7.77 0 2 3.1 +1Score > 19 indicates identity SDNCEDTPEAGYFAIAVVK
786 441.2004 1760.7727 1760.7828 -5.78 1 2 3.2 +1Score > 19 indicates identity WAMGFAGEGTNDSKFK + Oxidation (M)
1844 522.2372 2084.9199 2084.9295 -4.63 1 2 3.1 +1Score > 19 indicates identity VFQGKNEQGMAHAAMAYSK + 2 Deamidated (NQ); Oxidation (M)
3336 643.7925 2571.1411 2571.1622 -8.20 0 2 2.1 +1Score > 18 indicates identity DGDIVGVSWGTTMYQIAQNMQPK + Deamidated (NQ); 2 Oxidation (M)
4790 765.3478 2293.0215 2293.0209 0.28 0 2 3.2 +1Score > 19 indicates identity CNPLAGDPENSYDVDFIPLR + 2 Deamidated (NQ)
1733 522.2372 2084.9199 2084.9077 5.82 1 2 3.1 +1Score > 19 indicates identity NEQGMAHAAMAYSKQMLR + Deamidated (NQ); 3 Oxidation (M)
3443 657.2986 2625.1655 2625.1408 9.40 0 2 3.2 +1Score > 19 indicates identity DLQPNTTYFWYAAASDQYGGNSR + Deamidated (NQ)
4778 765.3478 2293.0215 2293.0597 -16.7 0 2 3.2 +1Score > 19 indicates identity QQVDYNDDSIQVLEGLEAVR + 3 Deamidated (NQ)
1937 535.7434 1069.4723 1069.4539 17.2 0 2 1.8 +1Score > 17 indicates identity CFDWLSNK + Deamidated (NQ)
1973 535.7434 1069.4723 1069.4750 -2.55 1 2 1.8 +1Score > 17 indicates identity MDQFKQEK + Deamidated (NQ); Oxidation (M)
3633 670.8048 2679.1901 2679.2349 -16.7 1 2 2.5 +1Score > 18 indicates identity NAQITKMLDFAFSQYETHPMYK + Deamidated (NQ); Oxidation (M)
3820 684.3109 2049.9109 2049.9392 -13.8 1 2 3.2 +1Score > 19 indicates identity RYGFIHVDQDDDGNGTLK + Deamidated (NQ)
5954 859.8907 3435.5339 3435.5551 -6.18 1 2 1.6 +1Score > 16 indicates identity TQMLNKQYEAVERPQQTDAAEFTFAQLEK + 6 Deamidated (NQ); Oxidation (M)
2703 589.7679 2355.0427 2355.0246 7.68 0 2 2 +1Score > 17 indicates identity VDAFNQMEGIMNELNDTGLNK + 3 Deamidated (NQ)
7178 954.4337 3813.7058 3813.7542 -12.7 1 2 2.7 +1Score > 19 indicates identity EGNSFQQAFLQGMFTVPGDGCIDFREVYQTLLK + 3 Deamidated (NQ); Oxidation (M)
416 414.1881 826.3617 826.3643 -3.15 0 2 3 +1Score > 19 indicates identity MASTFDR
1620 508.7311 1015.4477 1015.4610 -13.1 0 2 1.6 +1Score > 16 indicates identity EWAQQPEK + Deamidated (NQ)
1068 468.2127 934.4109 934.4145 -3.85 0 2 2.9 +1Score > 19 indicates identity TGEPFDNR
1473 495.2250 988.4354 988.4219 13.7 0 2 2.9 +1Score > 19 indicates identity GNHEVMMR + Oxidation (M)
2768 603.2741 2409.0673 2409.0976 -12.6 0 2 3 +1Score > 19 indicates identity ILMIEDNLSVCTMTEMFFAK + Deamidated (NQ); Oxidation (M)
3424 657.2986 1968.8741 1968.9065 -16.5 1 2 3.3 +1Score > 19 indicates identity EYSTDGTAEKGGDLGWVGK
5725 832.8785 1663.7424 1663.7294 7.83 0 2 1.9 +1Score > 17 indicates identity GEMIDMINNGNGQVR + Deamidated (NQ); Oxidation (M)
5302 805.8662 1609.7179 1609.7327 -9.22 1 2 2.7 +1Score > 19 indicates identity SSKAMQALQPEMQK + 2 Deamidated (NQ); 2 Oxidation (M)
2741 603.2741 2409.0673 2409.1127 -18.8 1 2 3 +1Score > 19 indicates identity AEVEIEIQVHGMTCMFQSKR + Deamidated (NQ); Oxidation (M)
3204 630.2864 1258.5582 1258.5578 0.32 0 2 3.2 +1Score > 19 indicates identity AEAVNDQFHAR + 2 Deamidated (NQ)
140 387.1759 1544.6744 1544.6824 -5.17 1 2 1.8 +1Score > 17 indicates identity CQHCQKNEATIR + Deamidated (NQ)
1083 468.2127 1868.8217 1868.8284 -3.59 1 2 2.9 +1Score > 19 indicates identity IDDMRDNEFPIMETK + Oxidation (M)
2541 576.2618 1725.7637 1725.7855 -12.6 0 2 3.4 +1Score > 20 indicates identity AWCYVDDMIDGILR
885 454.7066 1814.7972 1814.8186 -11.8 0 2 2.7 +1Score > 19 indicates identity GTFTMVFDHYEEVPK + Oxidation (M)
2842 603.2741 1204.5337 1204.5459 -10.1 0 2 3.1 +1Score > 19 indicates identity DDLSNIEEAAK + Deamidated (NQ)
4024 697.8171 1393.6196 1393.6222 -1.85 1 2 2.1 +1Score > 17 indicates identity ESAEEFRNQGAR + Deamidated (NQ)
4960 778.8539 3111.3864 3111.3925 -1.94 1 2 2.5 +1Score > 18 indicates identity GAEITISASGADENDALSALEETMKSEGLGE + Deamidated (NQ); Oxidation (M)
286 400.6820 1598.6989 1598.6812 11.1 0 2 1.5 +1Score > 16 indicates identity MLMQVMQDPEMAK + 3 Oxidation (M)
3916 697.8171 2787.2392 2787.2163 8.22 1 2 2.1 +1Score > 17 indicates identity HIDYNGRLCMSAAATAANQTFGMDR + Deamidated (NQ); Oxidation (M)
3957 697.8171 2787.2392 2787.2619 -8.14 1 2 2.1 +1Score > 17 indicates identity EAVMTDDEVQIMIQPPSEYKEFR + Deamidated (NQ); 2 Oxidation (M)
1618 508.7311 2030.8955 2030.9288 -16.4 1 2 1.6 +1Score > 16 indicates identity NSMKNSIIQGMLTAFANR + 4 Deamidated (NQ); 2 Oxidation (M)
4438 738.3355 2211.9847 2212.0028 -8.16 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MDNQELTMPTKYDPSAVEK + Oxidation (M)
357 414.1881 1239.5426 1239.5554 -10.3 1 2 3.1 +1Score > 19 indicates identity FQAQEREMGK + Deamidated (NQ); Oxidation (M)
602 427.6943 853.3741 853.3786 -5.31 1 2 1.5 +1Score > 16 indicates identity QMMKQR + Deamidated (NQ); 2 Oxidation (M)
829 441.2004 1760.7727 1760.8039 -17.8 0 2 3.3 +1Score > 19 indicates identity EMDHFLSLNPGLQSR + 2 Deamidated (NQ); Oxidation (M)
844 441.2004 1320.5795 1320.6058 -19.9 1 2 3.3 +1Score > 19 indicates identity DNNRVGFAEAAR + 2 Deamidated (NQ)
5608 832.8785 1663.7424 1663.7698 -16.4 0 2 1.9 +1Score > 17 indicates identity LLNFMSEHMTANEK
938 454.7066 907.3986 907.3957 3.23 0 2 2.7 +1Score > 19 indicates identity EMNGLAEK + Deamidated (NQ); Oxidation (M)
5701 832.8785 3327.4848 3327.5217 -11.1 1 2 2 +1Score > 17 indicates identity NGIPCTFNRAGSMIGFFFTNGPVINYDTAK + 3 Deamidated (NQ); Oxidation (M)
7331 967.9399 3867.7304 3867.7446 -3.67 0 2 1.8 +1Score > 17 indicates identity SALGSGAGNTGDFLIVNNGINATNYIDPDVSDQNVVGNA + 5 Deamidated (NQ)
1117 468.2127 934.4109 934.4178 -7.42 1 2 3 +1Score > 19 indicates identity DKQEMER
2701 589.7679 1177.5213 1177.5099 9.75 1 2 2 +1Score > 17 indicates identity GLADDDSDNKK + Deamidated (NQ)
2784 603.2741 2409.0673 2409.0828 -6.41 0 2 3.1 +1Score > 19 indicates identity MQLQVMNSPFNQEQAELLNR + 4 Deamidated (NQ); Oxidation (M)
3759 684.3109 1366.6073 1366.6113 -2.97 0 2 3.3 +1Score > 19 indicates identity DVQTYGSQGQQR + Deamidated (NQ)
3777 684.3109 1366.6073 1366.6221 -10.8 0 2 3.3 +1Score > 19 indicates identity GNQMAMAAGSATLK + Deamidated (NQ); Oxidation (M)
4114 711.3232 2130.9479 2130.9602 -5.75 0 2 3.3 +1Score > 19 indicates identity MGGQYIFSSVPIMNAEQNK + 2 Deamidated (NQ); Oxidation (M)
4767 765.3478 2293.0215 2293.0359 -6.29 0 2 3.4 +1Score > 19 indicates identity VGLENHAGHYPNELSGGQQQR + 3 Deamidated (NQ)
738 441.2004 1760.7727 1760.7642 4.81 0 2 3.3 +1Score > 19 indicates identity SPETSWTPSSNYSYR
1854 522.2372 1563.6899 1563.7174 -17.6 0 2 3.2 +1Score > 19 indicates identity QMQSFHGQMNVLK + Deamidated (NQ); Oxidation (M)
2528 576.2618 1725.7637 1725.7628 0.53 0 2 3.4 +1Score > 20 indicates identity MNQAIAADFQAADTSR + Deamidated (NQ); Oxidation (M)
62 387.1759 772.3372 772.3248 16.1 0 2 1.8 +1Score > 17 indicates identity MNAYMK + Oxidation (M)
2259 562.7557 2246.9936 2247.0100 -7.28 0 2 2.2 +1Score > 18 indicates identity IGNLQAEDEVIEMNQVEANK + 4 Deamidated (NQ)
3352 643.7925 1285.5705 1285.5570 10.5 0 2 2.2 +1Score > 18 indicates identity MLEQMNFIDK + 2 Deamidated (NQ); Oxidation (M)
1732 522.2372 1563.6899 1563.6987 -5.63 1 2 3.2 +1Score > 19 indicates identity MNHENREQYTLK + 2 Deamidated (NQ)
2178 549.2496 1644.7269 1644.7227 2.57 0 2 0.88 +1Score > 20 indicates identity
Score > 14 indicates homology		 DNAEDNEIIAEQER
7533 980.1954 3916.7526 3916.7243 7.23 1 2 1.6 +1Score > 16 indicates identity MIFYMAVRYEGDDGHPDLEMNNTTNNGSKPYHGK + Oxidation (M)
983 454.7066 1814.7972 1814.8033 -3.34 0 2 2.8 +1Score > 19 indicates identity GDTLWGISQNYGMNLK + 3 Deamidated (NQ); Oxidation (M)
4035 697.8171 2787.2392 2787.2619 -8.14 1 2 2.2 +1Score > 17 indicates identity EAVMTDDEVQIMIQPPSEYKEFR + Deamidated (NQ); 2 Oxidation (M)
Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 76 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/